[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF66015.1"

            "invasion protein IagB"
IAGB_SALTY  "RecName: Full=Invasion protein iagB;Flags: Precursor;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------12-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------423334422214422222212341--11--542-1-2--121---------1--1--------2-2----------1----1-13-1--3------1-----1-----1-----------------1-----------------------------------------1----11-22--1-1---21-3131112211------2--1----2111111121122211--111--12-2--------2----4--------------------------------1----------------1------2------------1------------1--11211111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTD:Sequence :ccccGGGccccccccHHHHHHHHTTcTTcTTccHHHHHHHHHHHTTcTTcEEEcTTccEE:Sec Str : ============================================:RP:SCP|17->151|1qsaA2|8e-17|26.2|130/168|d.2.1.6 :============================================================:BL:SWS|1->160|IAGB_SALTY|2e-91|100.0|160/160 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->128|PF01464|1e-09|37.0|100/113|SLT 61: . . . * . .: 120 :LGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGT:Sequence :ETTTTEETTTTccccccTTcccTTcGccGGGGGccccHHHHHHHHHHHTccGGGGcHHHH:Sec Str :============================================================:RP:SCP|17->151|1qsaA2|8e-17|26.2|130/168|d.2.1.6 :============================================================:BL:SWS|1->160|IAGB_SALTY|2e-91|100.0|160/160 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->128|PF01464|1e-09|37.0|100/113|SLT 121: . . + . . .: 180 :SPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK :Sequence :HHTTccGGGGGTTHHTTTcTTcccccHHH :Sec Str :=============================== :RP:SCP|17->151|1qsaA2|8e-17|26.2|130/168|d.2.1.6 :======================================== :BL:SWS|1->160|IAGB_SALTY|2e-91|100.0|160/160 :$$$$$$$$ :RP:PFM|24->128|PF01464|1e-09|37.0|100/113|SLT