[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66015.1 sent8 ACF66015.1 "invasion protein IagB"
MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTD
LGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGT
SPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
//