[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF66055.1"

            "MscS Mechanosensitive ion channel"
            ""

OrgPattern ---131------------------2222-222-11221222221-2-1-2----1-1-111----2-- -11--------------------------------------2-11-------1111-1--11-11---1--1---111-1---111-1--12-1--2---12-1112-21---------------21---111-22--------1-443232-1-111212-1421311111-11111-11111---------1---------------111111------1-111111111-111111111111111---1---1------1-1111----1--------------------------------------------------------------1-1-1--1111-----111--111-1111-1111--111-2---1-----1--------1111----------1-11111-1-11--211-13-321--1-2312112122311--------1---------------------------------------211----1-11-1---------1------21--1----1112-111---11112-11---1-------1-11-1222211-1--1--11111222232111123-1-1121------11111111122212--33-2212111-3122213311113132123---21--1-----12---112222222222-2222222222222222222-1-11--33323333333333333-2222221--111111111111---123223--1111111---1-1------1111111111--22-----212-21-112222---------232231211224432--------------1--1------111-11-1--1------------------------------------11 ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----11---2--2--1---1-11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEYLARLNIVAMLMSTTFWINLAVVFFVTLITYWLINWLLNVVYKALQRPDKKDDAHGRL:Sequence : :Sec Str 61: . . . * . .: 120 :RPIVFEMLKKTSKMLIFFAAFLFSLRFVALPDRLFSTLSHAWFLVVAIQMAIWLDQGVQS:Sequence : :Sec Str 121: . . + . . .: 180 :WMRHLLYAPGSNKNPVTLVILGMILRVLVWSMMLLSILANVGVDITALVASLGVGGIAIA:Sequence : HHHHHHHHHHHHHHHHHHHTTTcccTTHHHHHHHHHHHHH:Sec Str : ==============================================:RP:SCP|135->184|2oauA3|5e-06|30.0|50/86|f.34.1.1 : ======================:BL:SWS|159->347|Y1143_METJA|9e-22|29.6|189/361 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->343|PF00924|4e-29|37.1|197/203|MS_channel 181: . * . . . .: 240 :LAVQTVLSDVFASLSIGFDKPFEIGDFVVFNDVAGTIEHIGLKTTRIRSLSGEQIVCANA:Sequence :HHHTHHHHHHHHHHHHHTTccccTTcEEEccccEEEEEEEcccEEEEEcTTccEEEEEHH:Sec Str :==== :RP:SCP|135->184|2oauA3|5e-06|30.0|50/86|f.34.1.1 : ======================================================:RP:SCP|187->250|2oauA1|2e-13|29.7|64/67|b.38.1.3 :============================================================:BL:SWS|159->347|Y1143_METJA|9e-22|29.6|189/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->343|PF00924|4e-29|37.1|197/203|MS_channel 241: + . . . . *: 300 :QLLQQTIHNYKRMQTRRIVFTFGVATATPPEKLRLIGDMVKKIITDVGETQFDRAHLLAF:Sequence :HHHTcccEEcccccEEEEEEEEEEcTTccH HHHHHHHHHHHHHc TTEEEEEE:Sec Str :========== :RP:SCP|187->250|2oauA1|2e-13|29.7|64/67|b.38.1.3 : =================================================:RP:SCP|252->351|2oauA2|4e-14|18.6|97/101|d.58.43.1 :============================================================:BL:SWS|159->347|Y1143_METJA|9e-22|29.6|189/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|144->343|PF00924|4e-29|37.1|197/203|MS_channel 301: . . . . + .: 360 :GQDRLTYEVVHIVNTADYNKYMDIQQEINIRIIEKLIENDIELALPSLVVRAPVQVEETR:Sequence :ccccEEEEEEEEEETTTHHHHHHHHHHH :Sec Str :=================================================== :RP:SCP|252->351|2oauA2|4e-14|18.6|97/101|d.58.43.1 :=============================================== :BL:SWS|159->347|Y1143_METJA|9e-22|29.6|189/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|144->343|PF00924|4e-29|37.1|197/203|MS_channel 361: . . . * . .: 420 :DYSNTADAKNADKRVMQ :Sequence : :Sec Str