[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF66063.1"

            "cytochrome c type biogenesis protein CycH"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1----------------------------------------1--------------------------------1-------------------------------------------------------1----------------1111---1111111111-11111111111111111111--111112122222222222222111111111-111111111111---------11111--------------------------------------------------111111----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MINRPGISMKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDITGSQGNF:Sequence : ==================================================:BL:SWS|11->126|YJEI_SHIFL|5e-14|37.3|110/117 61: . . . * . .: 120 :FTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSKQTNVTLSG:Sequence :============================================================:BL:SWS|11->126|YJEI_SHIFL|5e-14|37.3|110/117 121: . . + . . .: 180 :NVYRCPR :Sequence :====== :BL:SWS|11->126|YJEI_SHIFL|5e-14|37.3|110/117