[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66063.1 sent8 ACF66063.1 "cytochrome c type biogenesis protein CycH"
MINRPGISMKKILVCFVGLALTACSANSLNYGAEQVRVMTSEPGKECSYLGDITGSQGNF
FTGGWTSNSNLETGARNDLKNKAYKMGGNTVVLLTQRAGQTGSSWHGSGSSKQTNVTLSG
NVYRCPR
//