[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF66317.1"

            "putative stability protein StbD"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1--1-------------------------------------------------------------------------------1---11---------------1------------------------------1-------2-----------1-------------1----------------------------------------21---1---------------------------------------11--------1--------1-------------1--2112-----12--11--1--1-------1--1--------------------11------1---------111-----2----11--------1----------1----------1-1122222------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDE:Sequence : EEEEHHHHHHTHHHHHHHHHTccEEEEcTTccEEEEccHHHHHHHHHHHHHH:Sec Str : ===================================================:RP:SCP|10->81|2a6qA1|1e-07|22.2|72/83|d.306.1.1 : =========================================================:BL:SWS|4->69|YAFN_ECOLI|7e-06|36.5|63/97 61: . . . * . .: 120 :ELGRIIDERANERVIEVNIDDL :Sequence :HcHHHHHHHHTTcccccccccH :Sec Str :===================== :RP:SCP|10->81|2a6qA1|1e-07|22.2|72/83|d.306.1.1 :========= :BL:SWS|4->69|YAFN_ECOLI|7e-06|36.5|63/97