[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66317.1 sent8 ACF66317.1 "putative stability protein StbD"
MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDE
ELGRIIDERANERVIEVNIDDL
//