[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF66348.1"

            "starvation-sensing protein RspB"
            ""

OrgPattern 231-2-9AFEDFEHF9284314-181114262----------------1-111-11121114322-45 96D-93154441-26BA88-8E22DR888888GMNNCLTO276AF7932421DAH624112285A3GFB922111-2----1C112111132-2-----2-2-3-71432--------------121-1-111--146643111286337221--------1--225878-------------54344541729444444562554445B66666444421283233333234233333333433334334451-5--3-6--144661-2123383223221222211222222223232222222222222322---222232-16332333323274111-1-1-21-111--212141221222231-3638622511--175B9B5-68855644544554446-65437747487-FFEAKFIGGDIL672436386678947444444446654-122------------------------------3A722-2223B99A9BA8687BBCE99991789C4B66--228232646542562-2-2-13-21211213155112321--1--12----33312122134945C34-----111111--------------33121234429312211223232211121121---131-------2654235C99DCDDDBC-9CBACBBBAC9CBCCBCC668656442A5B6B9D9ADC6A66A775677691-233333333333---1111113222112981113-2-111--23-33445151219175673735456564464111212111-1111111-11211145645442334222--11111111--------1--------31--1-------2------1311124333262 ----843-31---24INNLKHRFVVSKAA78678888A59776887GFGLJPggCFD99A7966D17355468378968A37766754-EZDN8E5IEC766AA6C-442O532362311128267293Da9-B6C4212412642321222262B36B5961973463984537346-711-35B8FOLGG33ONKG3 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----

Master   AminoSeq   


1: . . . . + .: 60 :MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE:Sequence :cEEEEEEETTEEEEEEcccccccTTcEEEEEEEEEccHHHHHHHHccTTcccccEEcccE:Sec Str : ###:PROS|58->72|PS00059|ADH_ZINC|PDOC00058| :============================================================:RP:SCP|1->163|1bxzA1|5e-36|18.4|163/178|b.35.1.2 :============================================================:BL:SWS|1->339|RSPB_ECOLI|e-157|75.2|339/339 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->127|PF08240|2e-29|52.4|103/108|ADH_N 61: . . . * . .: 120 :FFGVIDAVGDNVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY:Sequence :EEEEEEEEcTTcccccTTcEEEEcccccccccHHHHTTcGGGTTcTTTTTccccccccEE:Sec Str :############ :PROS|58->72|PS00059|ADH_ZINC|PDOC00058| :============================================================:RP:SCP|1->163|1bxzA1|5e-36|18.4|163/178|b.35.1.2 :============================================================:BL:SWS|1->339|RSPB_ECOLI|e-157|75.2|339/339 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->127|PF08240|2e-29|52.4|103/108|ADH_N 121: . . + . . .: 180 :AVAPARNAHRIPDNIADHHAVMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQAL:Sequence :EccHHHHcEEccTTccHHHHTTTTHHHHHHHHHHHTTccTTccEEEEcccHHHHHHHHHH:Sec Str :=========================================== :RP:SCP|1->163|1bxzA1|5e-36|18.4|163/178|b.35.1.2 : ============================================:RP:SCP|137->306|1pqwA|6e-13|8.3|169/183|c.2.1.1 :============================================================:BL:SWS|1->339|RSPB_ECOLI|e-157|75.2|339/339 :$$$$$$$ :RP:PFM|25->127|PF08240|2e-29|52.4|103/108|ADH_N : $$$$$$$$$:RP:PFM|172->290|PF00107|2e-07|31.6|117/128|ADH_zinc_N 181: . * . . . .: 240 :KGVYQVKTVIVVDRIEERLAMAKQSGADWTLNNGQHSLAEFLQQKALKPTLIVDAACHPA:Sequence :HHTTTcccEEEEcccHHHHHHHHHHTccEEEcGGGccHHHHHHHHHHTTTccEEEEEcTT:Sec Str :============================================================:RP:SCP|137->306|1pqwA|6e-13|8.3|169/183|c.2.1.1 :============================================================:BL:SWS|1->339|RSPB_ECOLI|e-157|75.2|339/339 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|172->290|PF00107|2e-07|31.6|117/128|ADH_zinc_N 241: + . . . . *: 300 :ILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIYSSRLNANKFPVVIDWLNKGL:Sequence :HHHHHHHHEEEEEEEEEcccccccccTTTTTTcccEEEEccccccHHHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|137->306|1pqwA|6e-13|8.3|169/183|c.2.1.1 :============================================================:BL:SWS|1->339|RSPB_ECOLI|e-157|75.2|339/339 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|172->290|PF00107|2e-07|31.6|117/128|ADH_zinc_N 301: . . . . + .: 360 :IDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFAK :Sequence :ccGGGGEEEEEcTHHHHHHHHHHHcccTTccEEEEEccc :Sec Str :====== :RP:SCP|137->306|1pqwA|6e-13|8.3|169/183|c.2.1.1 :======================================= :BL:SWS|1->339|RSPB_ECOLI|e-157|75.2|339/339