[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66348.1 sent8 ACF66348.1 "starvation-sensing protein RspB"
MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGDNVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEY
AVAPARNAHRIPDNIADHHAVMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQAL
KGVYQVKTVIVVDRIEERLAMAKQSGADWTLNNGQHSLAEFLQQKALKPTLIVDAACHPA
ILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIYSSRLNANKFPVVIDWLNKGL
IDPDKLITHTFDYQHVTDAIELFEKDQRQCCKVLLTFAK
//