[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF66695.1 sent8 ACF66695.1 "hypothetical protein"
MTEITLKNDLKQKSRDRVTVKPADFASQISFLRSQLKKLINILATF
//