[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF66838.1"

            "propanol dehydrogenase"
            ""

OrgPattern 11111-11112112111----1-3------1---1---1---111-11--111-1211221-22--12 -11-----222----------1--15-----151113486-1------1---131-------1--12----21112323122211-1132231222-----11-121--1---------------2233212221222222111112-11--111-----11---1111---------------1---443433222223332333333625453333263512344444531111111111111111-22--313-22-21-1223322311112111111111111122222222222-11111111111122212-22212447A555555585947GG4897564123552244469122326424223-111--------1-311---2522311111111112--16--4-2421-4553323844334-112-143233211212222223--1--12-----------------------------1-2212-54143234433222233222333325125762-1132121112244341111--121-------1--111-753C457479666-43442-6B3----221-1112----1------------1-----75A32-224143444446844444545474-----1-------74663415557577765-55555765555765555568A9453347756676666666666434344451-333334333333---------1111-2326333415--------233334333332133231522554313222---111-1-233354444456545-----------------2111111--------1-1------------------1------3223442334-11 --2211--21-4--1324323222322111222333222212211111232373221111111---1-1------11111------21--12221211112-2111-15111121221-1111111-1-251--3111-11-1111111-1-1111111111-31-11127112--322811-2-----3--1-----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNTFSLQTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSE:Sequence :cccccccccEEEcTTGGGHHHHTTccEEEEEccHHHHHTTTTHHHHHHHHHTTEEEEEcc:Sec Str : ===========================================================:RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2 : ============================================:BL:SWS|17->277|ADH2_ENTHI|4e-53|48.0|256/870 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->360|PF00465|2e-68|45.5|345/364|Fe-ADH 61: . . . * . .: 120 :ITPAPTIHTVVQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTT:Sequence :ccccccHHHHHHHHHHHHTTTccEEEEEccHHHHHHHHHHHHHTTcGGGccccEEEEccc:Sec Str :============================================================:RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2 :============================================================:BL:SWS|17->277|ADH2_ENTHI|4e-53|48.0|256/870 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->360|PF00465|2e-68|45.5|345/364|Fe-ADH 121: . . + . . .: 180 :SGTGSEVTSACVISDPDKGIKYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHA:Sequence :ccccTTTccEEEEEccTTccEEEEEcTTccccEEEEcHHHHTTccHHHHHHHHHHHHHHH:Sec Str : ###########################:PROS|154->182|PS00913|ADH_IRON_1|PDOC00059| :============================================================:RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2 :============================================================:BL:SWS|17->277|ADH2_ENTHI|4e-53|48.0|256/870 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->360|PF00465|2e-68|45.5|345/364|Fe-ADH 181: . * . . . .: 240 :LEAWVSPRASDFTDALAEKAAKLVFQYLPTAVEKGDCVATRGKMHNASTLAGMAFSQAGL:Sequence :HHHHccccccHHHHHHHHHHHHHHHTTHHHHHTcTTcHHHHHHHHHHHHHHHHHHTTTcc:Sec Str :## :PROS|154->182|PS00913|ADH_IRON_1|PDOC00059| :============================================================:RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2 :============================================================:BL:SWS|17->277|ADH2_ENTHI|4e-53|48.0|256/870 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->360|PF00465|2e-68|45.5|345/364|Fe-ADH 241: + . . . . *: 300 :GLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPRAAKRYARLAKACGFCPAEANDI:Sequence :cHHHHTTHHHHHHHcccHHHHHHHHHHHHHHHHGHTGGcTTHHHHHHHTTTcccTTccHH:Sec Str : XXXXXXXXXXXX :SEG|278->289|raakryarlaka :============================================================:RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2 :===================================== :BL:SWS|17->277|ADH2_ENTHI|4e-53|48.0|256/870 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->360|PF00465|2e-68|45.5|345/364|Fe-ADH 301: . . . . + .: 360 :AAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTLRTNPRPANAE:Sequence :HHHHHHHHHHHHHHHHHTccccTTTTTccGGGTTccHHHHHHHHHHcGGGGGccccccHH:Sec Str :============================================================:RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->360|PF00465|2e-68|45.5|345/364|Fe-ADH 361: . . . * . .: 420 :AIRELLEELL :Sequence :HHH :Sec Str : XXXXXX :SEG|364->369|elleel :=== :RP:SCP|2->363|1rrmA|8e-78|32.2|354/385|e.22.1.2