[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67239.1"

            "transcriptional regulator HilD"
HILD_SALTY  "RecName: Full=Transcriptional regulator hilD;"

OrgPattern -------------------------------------------------------------------- ---------------------1---------------1----------------------------------------------------11---------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------1--11---------------1------------------------------------------------------------------------------1------------------------------1--------------1---------------------------1-----------------------------11---2------1111---1-1--1----1----------------12--7775757596-8586655557867457854---1---1556665655455646515537568--111111111111---------------2-1---------------1122111------------11-------------------31-2222214223------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MENVTFVSNSHQRPAADNLQKLKSLLTNTRQQIKSQTQQVTIKNLYVSSFTLVCFRSGKL:Sequence : :Sec Str :============================================================:BL:SWS|1->309|HILD_SALTY|e-170|99.7|309/309 61: . . . * . .: 120 :TISNNHDTIYCDEPGMLVLKKEQVVNVTLEEVNGHMDFDILEIPTQRLGALYALIPNEQQ:Sequence : :Sec Str :============================================================:BL:SWS|1->309|HILD_SALTY|e-170|99.7|309/309 121: . . + . . .: 180 :TKMAVPTEKAQKIIYTPDFPARREVFEHLKTAFSCTKDTSKGCSNCNNKSCIENEELIPY:Sequence : :Sec Str :============================================================:BL:SWS|1->309|HILD_SALTY|e-170|99.7|309/309 181: . * . . . .: 240 :FLLFLLTAFLRLPESYEIILSSAQITLKERVYNIISSSPSRQWKLTDVADHIFMSTSTLK:Sequence : ccHHHHHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHH:Sec Str :XXXXXXXXXXXX :SEG|181->192|fllflltaflrl : ============================================:RP:SCP|197->303|1v4aA1|2e-16|12.1|107/151|a.24.16.4 :============================================================:BL:SWS|1->309|HILD_SALTY|e-170|99.7|309/309 241: + . . . . *: 300 :RKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKCGYDSTSYFIQCFKKYFKTTP:Sequence :HHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccH:Sec Str : ###########################################:PROS|258->300|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| :============================================================:RP:SCP|197->303|1v4aA1|2e-16|12.1|107/151|a.24.16.4 :============================================================:BL:SWS|1->309|HILD_SALTY|e-170|99.7|309/309 301: . . . . + .: 360 :STFIKMANH :Sequence :HHHHT :Sec Str :=== :RP:SCP|197->303|1v4aA1|2e-16|12.1|107/151|a.24.16.4 :========= :BL:SWS|1->309|HILD_SALTY|e-170|99.7|309/309