[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67256.1"

            "scaffolding protein"
VG08_BPP22  "RecName: Full=Scaffolding protein;AltName: Full=Protein gp8;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-11---1------1----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------1-----1-------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEIVLKDDETAPKQDPAKN:Sequence : :Sec Str :============================================================:BL:SWS|1->303|VG08_BPP22|e-161|100.0|303/100 61: . . . * . .: 120 :AEFARRRIERKRQRELEQQMEAVKRGELPESLRVNPDLPPQPDINAYLSEEGLAKYDYDN:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|65->79|rrrierkrqreleqq :============================================================:BL:SWS|1->303|VG08_BPP22|e-161|100.0|303/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|80->282|PF09306|4e-72|81.8|203/232|Phage-scaffold 121: . . + . . .: 180 :SRALAAFNAANTEWLMKAQDARSNAVAEQGRKTQEFTQQSAQYVEAARKHYDAAEKLNIP:Sequence : :Sec Str :============================================================:BL:SWS|1->303|VG08_BPP22|e-161|100.0|303/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|80->282|PF09306|4e-72|81.8|203/232|Phage-scaffold 181: . * . . . .: 240 :DYQEKEDAFMQLVPPAVGADIMRLFPEKSAALMYHLGANPEKARQLLAMDGQSALIELTR:Sequence : :Sec Str :============================================================:BL:SWS|1->303|VG08_BPP22|e-161|100.0|303/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|80->282|PF09306|4e-72|81.8|203/232|Phage-scaffold 241: + . . . . *: 300 :LSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQMDAAASKGDVETYRKLKAKLK:Sequence : cccccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHT:Sec Str :============================================================:BL:SWS|1->303|VG08_BPP22|e-161|100.0|303/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|80->282|PF09306|4e-72|81.8|203/232|Phage-scaffold 301: . . . . + .: 360 :GIR :Sequence :Tcc :Sec Str :=== :BL:SWS|1->303|VG08_BPP22|e-161|100.0|303/100