[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF67256.1 sent8 ACF67256.1 "scaffolding protein"
MEPTTEIQATEDLTLSGDHAAASADSLVVDNANDNAGQEEGFEIVLKDDETAPKQDPAKN
AEFARRRIERKRQRELEQQMEAVKRGELPESLRVNPDLPPQPDINAYLSEEGLAKYDYDN
SRALAAFNAANTEWLMKAQDARSNAVAEQGRKTQEFTQQSAQYVEAARKHYDAAEKLNIP
DYQEKEDAFMQLVPPAVGADIMRLFPEKSAALMYHLGANPEKARQLLAMDGQSALIELTR
LSERLTLKPRGKQISSAPPADQPITGDVSAANKDAIRKQMDAAASKGDVETYRKLKAKLK
GIR
//