[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67354.1"

            "putative esterase YbdB"
YBDB_ECOLI  "RecName: Full=Esterase ybdB;         EC=3.1.-.-;AltName: Full=p15;"

OrgPattern -------------------------------------------------------------------- ----1-----1-------------------------11---1-1-111-111111-11----1-1111111-----------------1111-1111----111-1111----------------11111111111---11---1--------------------------------------1--11---1-1111111111111111--1111111111----------------------------------------------------------------------------------------------------------------------------------1---------1-------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------1111-1111----------------11---1----1------------------1-----1-----------------------------111-1----111111111111111111111-------------222212-2222222222-223222222222222222222211111222222222222222212222222--111111111111----11111---------111111111111111------------1111-1111----1111----------111111111111111111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFGLLHGGASAA:Sequence :ccccccccHHHHHHHHcccHHHHTTcEEEEEccccccEEEEEccTTTcTTccccHHHHHH:Sec Str : XXXXXXXXXX:SEG|51->62|gllhggasaala : ======================================:RP:SCP|23->130|1zkiA1|5e-18|23.4|107/126|d.38.1.5 :============================================================:BL:SWS|1->137|YBDB_ECOLI|3e-66|92.0|137/137 61: . . . * . .: 120 :LAETLGSMAGYLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFD:Sequence :HHHHHHHHHHHHTccTTcEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEc:Sec Str :XX :SEG|51->62|gllhggasaala :============================================================:RP:SCP|23->130|1zkiA1|5e-18|23.4|107/126|d.38.1.5 :============================================================:BL:SWS|1->137|YBDB_ECOLI|3e-66|92.0|137/137 121: . . + . . .: 180 :EQGRRCCTCRLGTAVMG :Sequence :TTccEEEEEEEEEEccc :Sec Str :========== :RP:SCP|23->130|1zkiA1|5e-18|23.4|107/126|d.38.1.5 :================= :BL:SWS|1->137|YBDB_ECOLI|3e-66|92.0|137/137