[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67435.1"

            "LysR substrate binding domain protein"
            ""

OrgPattern -------------------------------------------------------------------- 1-2-1-----1---21-----1---3------1----455-112-11-----1-1--3--1---1-333-----------1-211---11-------------------1--------------------------111-1---1162133312212--1-1-2418211111--11111-11--------325444447531333584213368445132621-12212299-11-1111-111111122-4-2--11-1-1---22--1-2----------------------------------------------------235333234313112221111411--112-1554311-1421-1----21-K55611111O7WPP64B8D5C66685568678M-DJHDAQEJHg51uccGafRzukccPJ6777DG65799CB55555555AHI7984A-----------------------------1-6D85CcUKg******ZSUVRvv**efffPl*v*aswe--cXZEBICBuHUHy79PA5669a822222221224I95211---11-5223-1---23-2-8B4B5K12--1----------------------33SJK996b6IG6GMNMKCJKLGIGMKIQHYO---23-3------GHCQ3MHIIIFIFEDGG-IGHGJECGHEIFKGGHHG8kwjNK59AG8GEGFGGFHEEEEEDkCB9778C4-I99AAAA89AAA---2-2--2445423TJQ878E3I122314212QQQQSBI597b4jlgkapqkScdegCTTW5653366462GOOaHGHHGMRRKIXYGIKIG3334111--2------------------------------------------------------21 -----------------------------------------------------------------------------------------------------------------------------------------------1--------------5----3------F--6-1--------11--9-----7---- --------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSM:Sequence :EEETTEEEEcHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccEEEE:Sec Str :============================================================:RP:SCP|1->105|1b9mA1|2e-20|14.3|105/122|a.4.5.8 : ==========================================================:BL:SWS|3->295|YHJC_ECOLI|3e-53|36.3|292/299 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->65|PF00126|1e-09|45.0|60/60|HTH_1 61: . . . * . .: 120 :TDEGEEFYQRCLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYP:Sequence :cHHHHHHHHHHHHHHHHHHHHHHHHcTccccEEEEEEEEcHHHHHHTcHHHHHHHHHHcT:Sec Str :============================================= :RP:SCP|1->105|1b9mA1|2e-20|14.3|105/122|a.4.5.8 : ============================:RP:SCP|93->296|1ixcA2|7e-24|13.1|199/205|c.94.1.1 :============================================================:BL:SWS|3->295|YHJC_ECOLI|3e-53|36.3|292/299 :$$$$$ :RP:PFM|6->65|PF00126|1e-09|45.0|60/60|HTH_1 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|91->294|PF03466|7e-17|34.0|194/207|LysR_substrate 121: . . + . . .: 180 :DIEIVLGTSDRKIDLIAERVDCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPH:Sequence :EEEEEccHHHHHHHHHTTcccEEEEccccTTccEEEEEEEEEcEEEEEcTTcTTTTTccc:Sec Str :============================================================:RP:SCP|93->296|1ixcA2|7e-24|13.1|199/205|c.94.1.1 :============================================================:BL:SWS|3->295|YHJC_ECOLI|3e-53|36.3|292/299 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|91->294|PF03466|7e-17|34.0|194/207|LysR_substrate 181: . * . . . .: 240 :SIDELMKSHRAVNFFSNHSLQIMEWKFTVDGSIASIKIPSSILVDNSEAFLSCGLAGLGV:Sequence :cHHHHHTcEEEEEcTTcTEEEcTHHHHHHHHHHHTcccEEEEEEccHHHHHHHHHHTccE:Sec Str :============================================================:RP:SCP|93->296|1ixcA2|7e-24|13.1|199/205|c.94.1.1 :============================================================:BL:SWS|3->295|YHJC_ECOLI|3e-53|36.3|292/299 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|91->294|PF03466|7e-17|34.0|194/207|LysR_substrate 241: + . . . . *: 300 :LHGLRPSLAPFIASGELTEILTDFPPPPKPVSLLYPDRRYLAPKVRVFIDWLCEVFGPDA:Sequence :EEEEEGGGccTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcTTccHHH:Sec Str : XXXXXX :SEG|265->270|ppppkp :======================================================== :RP:SCP|93->296|1ixcA2|7e-24|13.1|199/205|c.94.1.1 :======================================================= :BL:SWS|3->295|YHJC_ECOLI|3e-53|36.3|292/299 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|91->294|PF03466|7e-17|34.0|194/207|LysR_substrate 301: . . . . + .: 360 :HL :Sequence : :Sec Str