[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF67435.1 sent8 ACF67435.1 "LysR substrate binding domain protein"
MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSM
TDEGEEFYQRCLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYP
DIEIVLGTSDRKIDLIAERVDCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPH
SIDELMKSHRAVNFFSNHSLQIMEWKFTVDGSIASIKIPSSILVDNSEAFLSCGLAGLGV
LHGLRPSLAPFIASGELTEILTDFPPPPKPVSLLYPDRRYLAPKVRVFIDWLCEVFGPDA
HL
//