[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67448.1"

            "putative amidohydrolase family"
            ""

OrgPattern -------------------------11---1--------------1----21--------1------- 143-1---------21111-11--22111112-222-455------------3-12-1-------16---1--------13------------------1-1---2-121--------------------------22232---13---1----------------1---------------------11---1--2-1-2----221--1---11-1---12-11-----31-------------------------------------------------------------------------------------------1--------------------------1-----------4-------2-2--1112-------211---1--1-33323234312------1-1-12-111--121-133112111-1-111213--------------1--------------------------------19---111-3335331----11111111--4124234----2--1--111-2-1-----11-----------1---12------1-----11---1--------1--------------------------1--11----1112---11-2--1---21-1-21---1---------1------------------------------------21221--11-11111112111111----------1-------------------------11-----------------11111----11-2222252111122---------------112---------11111111------------------------------------------------------------------ ------1-------1--2----11-1------------------------2122--1---------------1-----------------21-131-1----1----------------------------------------------------------111---------32----------211-121--11--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MISLVPPLLSRTALLFLLTATGAATAARPAADIILHNGNIITLNDAQPQASALAISGSRI:Sequence : cEEEEEEEEEETTTTEEEEEEEEEETTEE:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|8->31|llsrtallflltatgaataarpaa : ============================:RP:SCP|33->155|1gkpA1|1e-13|16.2|117/123|b.92.1.3 : ===========================:BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 61: . . . * . .: 120 :VAIGDDTATDEWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDA:Sequence :EEEEcEEcTTTcccTTcEEEEcTTcEEEEcEEEEEEEcccTHHHcccGGGTTccTHHHHH:Sec Str :============================================================:RP:SCP|33->155|1gkpA1|1e-13|16.2|117/123|b.92.1.3 :============================================================:BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|98->175|PF00762|1e-04|33.8|77/315|Ferrochelatase 121: . . + . . .: 180 :LDKLRADANRRPHDQWVAVVGSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVN:Sequence :HHHHHHHHHHHccccccccGGGGTccccEEEEEEEEETTTTTTTTcEEEEEEEcTTcEEE:Sec Str :=================================== :RP:SCP|33->155|1gkpA1|1e-13|16.2|117/123|b.92.1.3 :============================================================:BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|98->175|PF00762|1e-04|33.8|77/315|Ferrochelatase 181: . * . . . .: 240 :QRGIDVLGLNDTPPPDLAGIGVERDAKGSATGKLFGDIAAFNQLFASISSNADREGGLRQ:Sequence :EcEEEcHHHHccccccccccGGGHHHHHTTcHHHTTcTHHHHHHHHHHccHHHHHHHHHH:Sec Str :============================================================:BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 241: + . . . . *: 300 :FFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRVGYRIPVQPEAKGHEAQWFSN:Sequence :HHHHHHHTTEEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccGGGTT:Sec Str :============================================================:BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 301: . . . . + .: 360 :LMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQVATFAAKRGIP:Sequence :cHHHHHHHHHTTHHHHHHTTcccEEEEcccTTcccHEGGGcccHHHHHHHHTTTTccccE:Sec Str : ==============:RP:SCP|347->558|2a3lA1|3e-17|14.1|185/616|c.1.9.1 :============================================================:BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 : $$$$$$$$$$$$$$$$$$:RP:PFM|343->528|PF07969|3e-10|32.6|175/378|Amidohydro_3 361: . . . * . .: 420 :LEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG:Sequence :EcccccccccTHHHHHHHHHHTTHHHHHcccccccGGGGGcHHHHHHHHHHTccEEEcHc:Sec Str :============================================================:RP:SCP|347->558|2a3lA1|3e-17|14.1|185/616|c.1.9.1 :=============================================== :BL:SWS|34->407|AEPA_PECCC|2e-15|25.8|360/465 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|343->528|PF07969|3e-10|32.6|175/378|Amidohydro_3 421: . . + . . .: 480 :PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIAS:Sequence :TTcTHHHHHHHTHHccHHHHTTTTcccTTccHHHHHHTTccEEEcccccHHHHcccccHH:Sec Str :============================================================:RP:SCP|347->558|2a3lA1|3e-17|14.1|185/616|c.1.9.1 : =======================================:BL:SWS|442->558|MTAD_SYMTH|4e-05|36.3|113/436 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|343->528|PF07969|3e-10|32.6|175/378|Amidohydro_3 481: . * . . . .: 540 :GGSVRKPASERLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQPFMTMPEDR:Sequence :HHHHHHHHHHHTccHHHHHHHHHHHHHHccccHHHHHHHccTTTTcccGGccHHHHcccH:Sec Str :============================================================:RP:SCP|347->558|2a3lA1|3e-17|14.1|185/616|c.1.9.1 :============================================================:BL:SWS|442->558|MTAD_SYMTH|4e-05|36.3|113/436 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|343->528|PF07969|3e-10|32.6|175/378|Amidohydro_3 541: + . . . . *: 600 :IDTIRAVLTLVDGRIVHESPDLNAGQ :Sequence :HHHHHHHHHTTTcccccccccEcc :Sec Str :================== :RP:SCP|347->558|2a3lA1|3e-17|14.1|185/616|c.1.9.1 :================== :BL:SWS|442->558|MTAD_SYMTH|4e-05|36.3|113/436