[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67703.1"

            "threonine/homoserine efflux transporter RhtA"
RHTA_SALTY  "RecName: Full=Inner membrane transporter rhtA;"

OrgPattern -------------------------------------------------------------------- -1--11112221-1----------13-----11111-223-----111-1-111-1----11111111122----1-----11------------------1-------1-------------------------------------------------------------------------111--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------1--1112------------------------------11-11111-2--2---11-111--------2-------111111111-111------------------------------------11-111-1--------------1---------1111--111--1--11----------------------1---1----------11---------------1------------------------------1-11----11------11--------1----------------1111-111111111111-111111-11111111111111111111111-1111111111-1111-1111--111111111111--1-------------1----------------3333322-----1111111111211--11--------------11111-----111---------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPGSTRKLPVWLPILVLLIAMSSIQSGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK:Sequence : XXXXXXXXXXXX :SEG|8->19|lpvwlpilvlli :============================================================:BL:SWS|1->295|RHTA_SALTY|e-141|95.9|295/295 61: . . . * . .: 120 :PWRLRFAKEQRLPLLFYGLSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV:Sequence :============================================================:BL:SWS|1->295|RHTA_SALTY|e-141|95.9|295/295 121: . . + . . .: 180 :DFIWVVLAVLGLWFLLPLGQDMSHVDLTGAALALGAGACWAVYILTGQRAGAEHGPATVA:Sequence : XXXXXXXXXXXX :SEG|147->158|ltgaalalgaga :============================================================:BL:SWS|1->295|RHTA_SALTY|e-141|95.9|295/295 181: . * . . . .: 240 :VGSLIAAIIFVPIGAVQAGDALWHWSILPLGLAVAVLSTALPYSLEMIALTRLPTRTFGT:Sequence : =========================================================:RP:SCP|184->274|1s7bA|1e-04|12.1|91/106|f.39.1.1 :============================================================:BL:SWS|1->295|RHTA_SALTY|e-141|95.9|295/295 241: + . . . . *: 300 :LMSMEPALAAVSGMIFLGETLTGIQIMALCAIIAASMGSTLTIRREPQIKQVDVK :Sequence :================================== :RP:SCP|184->274|1s7bA|1e-04|12.1|91/106|f.39.1.1 :======================================================= :BL:SWS|1->295|RHTA_SALTY|e-141|95.9|295/295