[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67711.1"

            "3-oxoacyl-[acyl-carrier-protein] synthase 1"
FABB_ECOLI  "RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 1;         EC=2.3.1.41;AltName: Full=3-oxoacyl-[acyl-carrier-protein] synthase I;AltName: Full=Beta-ketoacyl-ACP synthase I;         Short=KAS I;"

OrgPattern -------------------------------------------------------------------- 2261G1211111-1BBBFF-FAAAN7GFGGFCB98953462KCL1111121123211411ID21K3OVEQ2--------1112111111113111111-246542G66241111111111111111111211111122244111I3464466911111222113229CBU51111111111111111111121J111111112111111121146112111311111111183111111111111111111112-111111-1-11111111111111122211111241111111111111111111111111111111111111331111111111G1331111112--1211211311111111111111317222233333744333344533333333333333-3353443447425667446555554853253433333441111111112222213111111111111111111111111111111211112221453342EB76873345AAAA2C5641213124571233243156313222233111222212232251412512431422113435228453212VL331321111111111111111111111113432264334466666565666666556551-22221111111A2932432559277322-522222323353522222433483B742222222222222222522322222174545544545411243433366664293511113111111123111441132213944346A56352622858411111111234471222224644443333333322222212--1111--------1-1-------------------------1111111111191 1142Si3-311-11269A5GDHJGVJR222444GE56979488222HFCKB9D688IID757111111-111111211-111111111---19----------111-153J44243-2111221411215A2-1221111222411111-31141622122226513547954872334q433388459E473351223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLI:Sequence :cccEEEEEEEEEcTTcccHHHHHHHHHHTcccEEEcHHHHHTTccccEEEccccccTTcc:Sec Str :============================================================:RP:SCP|1->253|1dd8A1|2e-90|90.9|253/253|c.95.1.1 :============================================================:BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->246|PF00109|3e-12|30.4|227/245|ketoacyl-synt 61: . . . * . .: 120 :DRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAM:Sequence :cHHHHTTccHHHHHHHHHHHHHHHHHTccHHHHTTcTTEEEEEEcccccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->253|1dd8A1|2e-90|90.9|253/253|c.95.1.1 :============================================================:BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->246|PF00109|3e-12|30.4|227/245|ketoacyl-synt 121: . . + . . .: 180 :RSPRGLKAVGPYVVTKAMASGVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLG:Sequence :TcccTHHHHcccHHHHHcTTHHHHHHHTTTTccccEEccccGGGHHHHHHHHHHHHHHTT:Sec Str : ################# :PROS|154->170|PS00606|B_KETOACYL_SYNTHASE|PDOC00529| :============================================================:RP:SCP|1->253|1dd8A1|2e-90|90.9|253/253|c.95.1.1 :============================================================:BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->246|PF00109|3e-12|30.4|227/245|ketoacyl-synt 181: . * . . . .: 240 :KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV:Sequence :cccEEEEEEEEcccHHHHHHHHTTTccccccTTcGGGTccTTcTTccccccccEEEEEEE:Sec Str : XXXXXXXXXXXXX:SEG|228->240|gfviaggggmvvv :============================================================:RP:SCP|1->253|1dd8A1|2e-90|90.9|253/253|c.95.1.1 :============================================================:BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->246|PF00109|3e-12|30.4|227/245|ketoacyl-synt 241: + . . . . *: 300 :EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMQMAMHGVDTPIDYLNSHGT:Sequence :EEHHHHHHTTccccEEEEEEEEEEccccccccccHHHHHHHHHHTTTccccccEEEcccc:Sec Str :============= :RP:SCP|1->253|1dd8A1|2e-90|90.9|253/253|c.95.1.1 : ================================================:RP:SCP|253->404|1b3nA2|4e-28|42.1|152/161|c.95.1.1 :============================================================:BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 :$$$$$$ :RP:PFM|3->246|PF00109|3e-12|30.4|227/245|ketoacyl-synt : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|255->362|PF02801|4e-11|40.7|108/118|Ketoacyl-synt_C 301: . . . . + .: 360 :STPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN:Sequence :ccHHHHHHHHHHHHHHHTTcccEEEcTHHHHcccGGGHHHHHHHHHHHHHHHTEEccccc:Sec Str :============================================================:RP:SCP|253->404|1b3nA2|4e-28|42.1|152/161|c.95.1.1 :============================================================:BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|255->362|PF02801|4e-11|40.7|108/118|Ketoacyl-synt_C 361: . . . * . .: 420 :IEELDEQAAGLNIVTETTERELTTVMSNSFGFGGTNATLVMRKL :Sequence :cccccGGGcccccccccEEccccEEEEEEEETTTEEEEEEEEcc :Sec Str : XXXXXXXXXX :SEG|375->384|tettereltt :============================================ :RP:SCP|253->404|1b3nA2|4e-28|42.1|152/161|c.95.1.1 :============================================ :BL:SWS|1->404|FABB_ECOLI|0.0|94.6|404/406 :$$ :RP:PFM|255->362|PF02801|4e-11|40.7|108/118|Ketoacyl-synt_C