[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF67786.1"

            "head completion protein"
VG26_BPP22  "RecName: Full=Tail needle protein gp26;AltName: Full=Tail accessory factor gp26;AltName: Full=Packaged DNA stabilization protein;AltName: Full=Head completion protein;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11---------1-1------1---------1-11---1-1----1----111-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------1------------1-----11------------------------------------1-----------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQ:Sequence :cccGGGGccccccccccccccccTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->233|VG26_BPP22|e-127|99.6|233/233 61: . . . * . .: 120 :VKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVS:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->233|VG26_BPP22|e-127|99.6|233/233 121: . . + . . .: 180 :ALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAAT:Sequence :HHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEETTEEEEccccccccccc:Sec Str :============================================================:BL:SWS|1->233|VG26_BPP22|e-127|99.6|233/233 181: . * . . . .: 240 :GTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKALEDALRAHGLID :Sequence :cccccccccTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccc :Sec Str :===================================================== :BL:SWS|1->233|VG26_BPP22|e-127|99.6|233/233