[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF67786.1 sent8 ACF67786.1 "head completion protein"
MADPSLNNPVVIQATRLDASILPRNVFSKSYLLYVIAQGTDVGAIAGKANEAGQGAYDAQ
VKNDEQDVELADHEARIKQLRIDVDDHESRITANTKAITALNVRVTTAEGEIASLQTNVS
ALDGRVTTAENNISALQADYVSKTATTSQSLASPLNVTTSYSVGGKKVVGARQTGWTAAT
GTANKGVFDADLTFAVSDTYTQSEIQAIANALITERRRTKALEDALRAHGLID
//