[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68197.1"

            "ribosomal-protein-serine acetyltransferase"
            ""

OrgPattern --------------------------------------1111---------11--------1-1---- --1------------------------------------------------11-------------1--------------------------------------1-----------------------------------------------------1---------1---------------------1-11111111111111111-111111-1-11211------1-11111111111111111-11---2112----21--11----21------------------------------------------------1-------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1----------------------------1-----------------------------11------------------------1----------------11--11-1111111111--1111111-1-1111111111111---1111111111111111-1111111----------------------------1-1------1---------------------1111-----------1-----------1111-------111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-------------------------------------------------111------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNML:Sequence :cccEEEccTTcEEEEccGGGHHHHHHHTTTTccEEETTEEEccHHHHHHHHHHHHHcccE:Sec Str :============================================================:RP:SCP|1->176|1s7fA1|6e-18|90.2|173/173|d.108.1.1 :============================================================:BL:SWS|1->178|RIML_ECOLI|9e-70|68.0|178/179 61: . . . * . .: 120 :LHQRGYAKMYLIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTH:Sequence :EEcTTcTTEEEEEETTcEEEEEEEEEEETTTTEEEEEEccccGGcccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->176|1s7fA1|6e-18|90.2|173/173|d.108.1.1 :============================================================:BL:SWS|1->178|RIML_ECOLI|9e-70|68.0|178/179 121: . . + . . .: 180 :YARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD :Sequence :HHHHccccEEEEEEEEETTcccHHHHHTTcEEEEEEEEEEEETTEEEEEEEEEEHHHHc :Sec Str :======================================================== :RP:SCP|1->176|1s7fA1|6e-18|90.2|173/173|d.108.1.1 :========================================================== :BL:SWS|1->178|RIML_ECOLI|9e-70|68.0|178/179