[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68197.1 sent8 ACF68197.1 "ribosomal-protein-serine acetyltransferase"
MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNML
LHQRGYAKMYLIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTH
YARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
//