[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68332.1"

            "transporter, major facilitator family"
            ""

OrgPattern ------1-1222113----------------------------2-----------------1------ 329-------1------11-1---1711111--2221335----2---1---1-2--------11-9-2-------------1-----11-------------1-1-4-3----------------------------------1----1----------------------------------------12-2-----------------55-2-----21------------1111111111111111111-------1------------------------------------------------------------------2------------11--------------31-11----2----1--1-15558-----7-744--1-7--111111111112-34F22J3E----6113121311--62121--1-------21222222144--1--------------------------------2322-1----KPSURI86553QQSO888828KDLAFD6-1CA8-----5-1-3321-----21------------1-1-------1-------------------2-1-----11----------------------51-1--1--------1----------------1--------73631324436455545-4535655554354774776CFC7511-C5A8B8BBBB86A689A41-44441-255555554455---------1111---1----1-----------77676-3---B155544ABF2BCDE1777------------------------1123233222----11-------------------------------------------------------2- ------2-----113oq*ewlna****MNKKELLKLPQMOKOOFHHWQXp****uxiJMPOOWAN7AD2B33NBL754657EECQD79-QaXqTdHhOYBHAETHN-23-72--21--------41---231-2----------------1------1225724863332A-24-12-----147-233e111-1111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSITLLDGVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQIDTGLSNEAYALGAGIF:Sequence : HHHHHHHHTcHHHHHH HTTccTTccccHHHHHHHH:Sec Str : ===================================================:RP:SCP|10->196|1pw4A|7e-12|16.7|180/434|f.38.1.1 :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->306|PF07690|3e-17|32.5|268/347|MFS_1 61: . . . * . .: 120 :FVVYAFLGVPANLLMRKFGARTWIGTTTLLWGFLSAAMAWADSEAKFLIIRTLLGAAEAG:Sequence :HHHHHHHHHHHHHTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccc:Sec Str :============================================================:RP:SCP|10->196|1pw4A|7e-12|16.7|180/434|f.38.1.1 :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->306|PF07690|3e-17|32.5|268/347|MFS_1 121: . . + . . .: 180 :FFPGMIYLTSQWFPQRNRASIMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFV:Sequence :cccccccGGGccccEEEEHHHHccccTTccHHHHHHHHHcccEEEEEEEEccTTcTTccc:Sec Str :============================================================:RP:SCP|10->196|1pw4A|7e-12|16.7|180/434|f.38.1.1 :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->306|PF07690|3e-17|32.5|268/347|MFS_1 181: . * . . . .: 240 :IEGLLAIGAGIFTFFWLDDTPQQARFLSLEEKNALIRQLASEEEKKVTSRLADALRNGRV:Sequence :HHHHHHHHHHHHHHHHcccccccHHHHHHTHcccccTHHHHHH TcccHHH:Sec Str :================ :RP:SCP|10->196|1pw4A|7e-12|16.7|180/434|f.38.1.1 :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->306|PF07690|3e-17|32.5|268/347|MFS_1 241: + . . . . *: 300 :WQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVVTAVPWVAALLGTWLIPRYSD:Sequence :HHHHHHHHHHHHHHHHHHHHHHH :Sec Str :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->306|PF07690|3e-17|32.5|268/347|MFS_1 301: . . . . + .: 360 :RTGDRRNVAAVTLLAAGIGIGLSGLVSPVLAILALCVAAVGFIAVQPVFWTMPTQLLSGT:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|308->327|vaavtllaagigiglsglvs : XXXXXXXXXXXX :SEG|329->340|vlailalcvaav :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 :$$$$$$ :RP:PFM|25->306|PF07690|3e-17|32.5|268/347|MFS_1 361: . . . * . .: 420 :ALAAGIGFVNLFGAVGGFIAPILRVKAETLFASDAAGLLTLSGVAIIGSLIIFTLSVNRP:Sequence : :Sec Str :============================================================:BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429 421: . . + . . .: 480 :VAQSGAAHH :Sequence : :Sec Str :========= :BL:SWS|1->429|YFAV_ECOLI|0.0|87.4|429/429