[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68340.1"

            "fimbrial subunit"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---121111121--111--33333-11----1-----------------------1-------------------------------------------------------------------------11-------------------1---------------------A4--1778AAB899678-9549755A97A6A888884566-123D9475898888979759A5437774--122232222333---------------------------------222-2-------1111-1-1------1---------------------------1--------3232----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRA:Sequence : cccccccccccccccEEcccHHccccccEEEEEcccccc:Sec Str : =====================================:RP:SCP|24->172|2j2zB1|6e-26|22.5|142/150|b.2.3.2 :============================================================:BL:SWS|1->172|FIMF_ECOLI|1e-25|40.9|171/176 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->172|PF00419|2e-20|44.8|145/152|Fimbrial 61: . . . * . .: 120 :GDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNK:Sequence :ccccccEEEEEEEEEEcTTccEEEEEEEcccccccTTcEEccccTTccccEEEEEEcTTc:Sec Str :============================================================:RP:SCP|24->172|2j2zB1|6e-26|22.5|142/150|b.2.3.2 :============================================================:BL:SWS|1->172|FIMF_ECOLI|1e-25|40.9|171/176 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->172|PF00419|2e-20|44.8|145/152|Fimbrial 121: . . + . . .: 180 :TLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANASATFILAYE :Sequence :ccccTTccGGGccEEETTccEEEEEEEEEEEccccccccccccccEEEEEEc :Sec Str :==================================================== :RP:SCP|24->172|2j2zB1|6e-26|22.5|142/150|b.2.3.2 :==================================================== :BL:SWS|1->172|FIMF_ECOLI|1e-25|40.9|171/176 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|28->172|PF00419|2e-20|44.8|145/152|Fimbrial