[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68340.1 sent8 ACF68340.1 "fimbrial subunit"
MRNDILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRA
GDGSAWQPFAIDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNK
TLIPLGQESDVVTLSPGQASAHLQFYARYLADGGAVTPGDANASATFILAYE
//