[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68493.1"

            "AraC-family transcriptional regulator"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1---1-2-1------------------------1-----------3----------------1--2-7-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------111----------------2--------------------1-2--------------------------------2---11121----2-------1-1111-11-4------------112---1---------------------------------1-----1-----1------1-------------------------------------------------------1------------------2--1----------------------------------22---1--1111111111111----------1--------------------------11--------------------------1-1111-1-------111----------------------1--12----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSPISCHSSAAPAMKKIFSVSDFIAFGERYGIDYRFPALPQYTQSSPVLHGDIEEIALPG:Sequence : :Sec Str 61: . . . * . .: 120 :GICITRSDVHVLQPYETTSRHSSPLYMLVVLEGNVALAVNEQTFLLSAGMAFCSQLSEQQ:Sequence : :Sec Str : ====================================:BL:SWS|85->323|PCHR_PSEAE|2e-12|31.3|227/296 121: . . + . . .: 180 :TIRAHHGADSKLRTLSLGMYPDGGWRERLPVSLADEWENSATSARVWQVPEFLLSGLRYA:Sequence : :Sec Str :============================================================:BL:SWS|85->323|PCHR_PSEAE|2e-12|31.3|227/296 181: . * . . . .: 240 :QQPGPHAASRQLMLEGIMLQLLGYALNLCQPATQKRGLPVTGEYQRLELIRRLLEQTPEK:Sequence : TTc:Sec Str : XXXXXXXXXX :SEG|226->235|rlelirrlle : =====:RP:SCP|236->323|1v4aA1|2e-14|11.4|88/151|a.24.16.4 :============================================================:BL:SWS|85->323|PCHR_PSEAE|2e-12|31.3|227/296 241: + . . . . *: 300 :AYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLARARRYLMEGYSVQQAAWMSG:Sequence :ccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHTT:Sec Str : #######################:PROS|278->319|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| :============================================================:RP:SCP|236->323|1v4aA1|2e-14|11.4|88/151|a.24.16.4 :============================================================:BL:SWS|85->323|PCHR_PSEAE|2e-12|31.3|227/296 301: . . . . + .: 360 :YQHATNFATAFRRRYGCSPGELRDASLTASRHCA :Sequence :cccHHHHHHHHHHHHcccHHHHH :Sec Str :################### :PROS|278->319|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| :======================= :RP:SCP|236->323|1v4aA1|2e-14|11.4|88/151|a.24.16.4 :======================= :BL:SWS|85->323|PCHR_PSEAE|2e-12|31.3|227/296