[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68527.1"

            "tetratricopeptide repeat protein"
            ""

OrgPattern -------------------------------------------------------------------- -11------------------------------------------------------------------------------1--2---1111-1--Q---2----23-----------------82121-1112--------------------------------------------------------3------------------------------2---------1------------------------------------------------------------------------------------------------1111-111-1--11------------3-2-1------------G2--1---------1-3332322221111121221112-2212111-215-5---111-1-3-12122---1-11---11111111-----21---------------------------------1-A-----1112111----111111111-112111---1111----1--1----11--1--22221232131---2-12---21211--341--241--------332---1-----3436445442---322111--121-13155751--3334431-4-1--121-1-----------1-2223212-2--12422-12-21-2-12--3-------13-413-4334313113-1113332---11111111111----1111143442-2-1----11-3-32131221512-2241--2112112-1-1----------------211------1-211---------------18---11----------1-------------------------------------213 ----111-----333---------------------------------------------------------------------1----11---1-1-1--1-956153k211111-1111-1112-1-151-111-11-1-111-1---11-1111122-1111--112311241--Q8111--41-4-22--4534o --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----

Master   AminoSeq   


1: . . . . + .: 60 :MKKIFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDFNKTAISSDLKLLLADRYYF:Sequence : :Sec Str 61: . . . * . .: 120 :KDKTPCNTNTLSARAESMGLTTEEYINKIRSLRPAILDDRYFYLTVDQCDAGGTPMLTGI:Sequence : :Sec Str 121: . . + . . .: 180 :ELCTEALCGAEYMKRSSDLWLDDELQPTVKRQATTVVHMPLPYDKEKKLWKVTGWYLESS:Sequence : :Sec Str 181: . * . . . .: 240 :EETGEVMQSKQIAFEGYTNEENFANRQRVSVFKSFYESGNLKSIYHYNAQNKRDGKAETY:Sequence : :Sec Str : =============================================:RP:SCP|196->309|1h3iA1|6e-07|13.9|112/142|b.76.2.1 241: + . . . . *: 300 :FDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQGKIKDGECPHFYDNGVLKQKH:Sequence : :Sec Str :============================================================:RP:SCP|196->309|1h3iA1|6e-07|13.9|112/142|b.76.2.1 301: . . . . + .: 360 :SYLNQKLEGPAFEYFPDGKIKGKYSYSKGTIVGTSTEYYSTGKIRGVYHRNNQGENDGTF:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|318->329|gkikgkysyskg :========= :RP:SCP|196->309|1h3iA1|6e-07|13.9|112/142|b.76.2.1 : =:BL:SWS|360->474|YWQK_BACSU|2e-08|30.6|111/154 361: . . . * . .: 420 :EQYSEEGKLLSKATYKNGKQLSAQSWYENGHPKEESSFDSEGRKHGAVKEWFSNGKPASS:Sequence : ETTTEEEEEEccccTTccEEEE:Sec Str : ===================:RP:SCP|402->529|1h3iA1|8e-12|13.4|127/142|b.76.2.1 :============================================================:BL:SWS|360->474|YWQK_BACSU|2e-08|30.6|111/154 : $$$$$$:RP:PFM|415->499|PF03268|2e-04|34.1|82/353|DUF267 421: . . + . . .: 480 :KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGAD:Sequence :EEETTEEEEEEEccccccEEEEEc cEcTTccEEEEEEcTTccEEEEEEEcTTTEEEEEE:Sec Str :============================================================:RP:SCP|402->529|1h3iA1|8e-12|13.4|127/142|b.76.2.1 :====================================================== :BL:SWS|360->474|YWQK_BACSU|2e-08|30.6|111/154 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|415->499|PF03268|2e-04|34.1|82/353|DUF267 : $$$$$$$$:RP:PFM|473->541|PF09318|1e-04|36.8|68/200|DUF1975 481: . * . . . .: 540 :RRWSERTGKLVEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKY:Sequence :EEEcTTccEEEEEc cTTcccEEEEEEEcTTccEEEEEEEETTEEEEccTTTccTTTHH:Sec Str :================================================= :RP:SCP|402->529|1h3iA1|8e-12|13.4|127/142|b.76.2.1 : ======:BL:SWS|535->695|YBEQ_ECOLI|2e-18|35.4|161/325 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|415->499|PF03268|2e-04|34.1|82/353|DUF267 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|473->541|PF09318|1e-04|36.8|68/200|DUF1975 541: + . . . . *: 600 :IRCYHNDEELSELYAPTDVTNKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHP:Sequence :HHccccHHHHTcGGGccccccHHTTTcTHHHHHHHHHHcGGccHHHHHHHHHHHHHTTcH:Sec Str : ==================:RP:SCP|583->714|1klxA|3e-15|23.0|126/133|a.118.18.1 :============================================================:BL:SWS|535->695|YBEQ_ECOLI|2e-18|35.4|161/325 :$ :RP:PFM|473->541|PF09318|1e-04|36.8|68/200|DUF1975 601: . . . . + .: 660 :GALLFLAYAYNDGDGVAQDSKKYLSYLFKAAELGESDAQLEVGYLNLIGEGMPKNLPEAY:Sequence :HHHHHHHHHHHHcccccccHHHHHHHHHTTTTTTcHHHHHHHHHHHHHTccccccHHHHH:Sec Str :============================================================:RP:SCP|583->714|1klxA|3e-15|23.0|126/133|a.118.18.1 :============================================================:BL:SWS|535->695|YBEQ_ECOLI|2e-18|35.4|161/325 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|636->670|PF08238|9e-05|48.6|35/36|Sel1 661: . . . * . .: 720 :KWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLTAAVKGGVKPALAALKELTPQ:Sequence :HHHHHHHHTTcTTTTHHHHHHHHTcTTccccHHHHHHHHHHHGGGccHHHHHHHHHHcHH:Sec Str :====================================================== :RP:SCP|583->714|1klxA|3e-15|23.0|126/133|a.118.18.1 :=================================== :BL:SWS|535->695|YBEQ_ECOLI|2e-18|35.4|161/325 :$$$$$$$$$$ :RP:PFM|636->670|PF08238|9e-05|48.6|35/36|Sel1 721: . . + . . .: 780 :TK :Sequence : :Sec Str