[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68527.1 sent8 ACF68527.1 "tetratricopeptide repeat protein"
MKKIFITIIVSLYCANICAKQSPSTESKPVNFIAQIENIDFNKTAISSDLKLLLADRYYF
KDKTPCNTNTLSARAESMGLTTEEYINKIRSLRPAILDDRYFYLTVDQCDAGGTPMLTGI
ELCTEALCGAEYMKRSSDLWLDDELQPTVKRQATTVVHMPLPYDKEKKLWKVTGWYLESS
EETGEVMQSKQIAFEGYTNEENFANRQRVSVFKSFYESGNLKSIYHYNAQNKRDGKAETY
FDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQGKIKDGECPHFYDNGVLKQKH
SYLNQKLEGPAFEYFPDGKIKGKYSYSKGTIVGTSTEYYSTGKIRGVYHRNNQGENDGTF
EQYSEEGKLLSKATYKNGKQLSAQSWYENGHPKEESSFDSEGRKHGAVKEWFSNGKPASS
KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGAD
RRWSERTGKLVEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKY
IRCYHNDEELSELYAPTDVTNKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHP
GALLFLAYAYNDGDGVAQDSKKYLSYLFKAAELGESDAQLEVGYLNLIGEGMPKNLPEAY
KWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLTAAVKGGVKPALAALKELTPQ
TK
//