[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68589.1"

            "conserved hypothetical protein"
YBEL_ECOLI  "RecName: Full=Uncharacterized protein ybeL;"

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---1--1-1111111111111111111---1111------11111111111111111-112111111111111111111111---1111111111111111111111111-111111111111------------------------------------------------------------------------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKVAQYYRELVASLSERLRNGERDIDALVEQARQRVMQTGELTRTEVDELTRAVRRDLE:Sequence :============================================================:BL:SWS|1->157|YBEL_ECOLI|2e-84|93.0|157/160 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->154|PF07295|8e-49|71.7|145/147|DUF1451 61: . . . * . .: 120 :EFAMSYEESQEDSVFLRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLG:Sequence :============================================================:BL:SWS|1->157|YBEL_ECOLI|2e-84|93.0|157/160 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->154|PF07295|8e-49|71.7|145/147|DUF1451 121: . . + . . .: 180 :NLVCEKCHYHLAVYTPDVLPLCPKCGHDQFQRRPFEP :Sequence :===================================== :BL:SWS|1->157|YBEL_ECOLI|2e-84|93.0|157/160 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->154|PF07295|8e-49|71.7|145/147|DUF1451