[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68593.1 sent8 ACF68593.1 "conserved hypothetical protein"
MVRKRGVIKPLLNEIRFKLLELQQKENDGLLMLDKLSKHGINGLIRRQ
//