[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68745.1"

            "secreted effector protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------11-------------------31-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------2---------11--------------------------------------------------------------11----------1---1------------------------------1----------------------------------------221-3133212231-1----------1--------------------2222-------------------------------------------------31--11--1----11111111111------------------------------------------------------------------------- --------------1----------------------------------------------------------------------------------------3----------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPLSVGQGYFTSFISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQ:Sequence : HHHHHGGGccTTHHHHHHHHHHHHH cc:Sec Str :============================================================:BL:SWS|1->133|SIFA_SALTY|7e-07|32.6|129/336 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->110|PF06767|2e-15|43.4|106/312|Sif 61: . . . * . .: 120 :ELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEA:Sequence :cccccHHHHHHHHHHHHHHccHHHHTTEEEEcGGGcTTcEEEcTTcccEEEEEEEETTEE:Sec Str :============================================================:BL:SWS|1->133|SIFA_SALTY|7e-07|32.6|129/336 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->110|PF06767|2e-15|43.4|106/312|Sif 121: . . + . . .: 180 :FGLAKEINKSHPKPKNISLGDITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTN:Sequence :EEEEEcccTTccccccE TTTcEEEEEEcHHHHTTT ccTTTcccccG:Sec Str : ======================================:RP:SCP|143->405|1deoA|8e-14|18.7|203/233|c.23.10.4 :============= :BL:SWS|1->133|SIFA_SALTY|7e-07|32.6|129/336 : ======================================:BL:SWS|143->405|GCAT_AERHY|2e-19|32.2|258/335 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->313|PF00657|1e-04|31.2|144/201|Lipase_GDSL 181: . * . . . .: 240 :GFTWTEFLSSPHFLGKEMLNFAEGGSTSASYSCFNCIGDFVSNTDRQVASYTPSHQDLAI:Sequence :GGcHHHHHHHHHTTcEEEEEEEcTTcccccccccccGccccccHHHHHHHHHHHHcccEE:Sec Str :============================================================:RP:SCP|143->405|1deoA|8e-14|18.7|203/233|c.23.10.4 :============================================================:BL:SWS|143->405|GCAT_AERHY|2e-19|32.2|258/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->313|PF00657|1e-04|31.2|144/201|Lipase_GDSL 241: + . . . . *: 300 :FLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLVMGIPDLSLTPYGKHSDEKRK:Sequence :EEccTTTTcGGGTccHHHHHHHHHHHHHHcccccTTcEEEEEcccccccTTcccGGGccH:Sec Str :============================================================:RP:SCP|143->405|1deoA|8e-14|18.7|203/233|c.23.10.4 :============================================================:BL:SWS|143->405|GCAT_AERHY|2e-19|32.2|258/335 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->313|PF00657|1e-04|31.2|144/201|Lipase_GDSL 301: . . . . + .: 360 :LKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYDTENPYTHHGY:Sequence :HHHEEcTHHHHHHHHHHHHTcEEEGGGTccccTTTHHHHHHHHHHHcHHTcEEEcHHHHH:Sec Str :============================================================:RP:SCP|143->405|1deoA|8e-14|18.7|203/233|c.23.10.4 :============================================================:BL:SWS|143->405|GCAT_AERHY|2e-19|32.2|258/335 :$$$$$$$$$$$$$ :RP:PFM|145->313|PF00657|1e-04|31.2|144/201|Lipase_GDSL 361: . . . * . .: 420 :VHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTE :Sequence :HHHHHHHcHHHHcHHHTcccccccccHHHHHHHHHHHHHHHHHHT :Sec Str :============================================= :RP:SCP|143->405|1deoA|8e-14|18.7|203/233|c.23.10.4 :============================================= :BL:SWS|143->405|GCAT_AERHY|2e-19|32.2|258/335