[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68745.1 sent8 ACF68745.1 "secreted effector protein"
MPLSVGQGYFTSFISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQ
ELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEA
FGLAKEINKSHPKPKNISLGDITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTN
GFTWTEFLSSPHFLGKEMLNFAEGGSTSASYSCFNCIGDFVSNTDRQVASYTPSHQDLAI
FLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLVMGIPDLSLTPYGKHSDEKRK
LKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYDTENPYTHHGY
VHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYSTE
//