[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF68874.1"

            "pirin protein"
            ""

OrgPattern ------11111111-1-1111---1-----1------------111-1--1-3--------111---- 12212--1111---43311-13--33111112333325441322-112----1111-1----2-1-1242----------1------------1-----2-2-42463-2---------------1--111----1----------1111111-1111-111111-22221--------1----------111-11111111-1-111-1-----111-22--11------12-------------------------------------------------------------------------------------------1212---1-1--1-1-11-1111--11-----11---------------2-12222-----21123222211121111111-112-11111111122-22211212212211232221--1122211111111-221131------------------------------122221232336776774333255455455356544444-23343333343426-341223321-------2122424---1-1-1-1--112-11-11--3323541-1-1----------------------11212112221212222221-2222111121----1--2------2123-111111111111-111111111111111111122211-132222222222222222311111111-222222222222---3-----112111341111--1-----111-4445433--4234444324333232133311---11-111112111111-1114534344333------1-332222------------------------------------------------1 ----832-----11111111111111111111111111111111111111122311111111512-11-12-111-----144426---132122611112-1212-3243111-12111-1111111-232-11111111-1111111111-11--12222112--------111112M21212234614144B9344 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGE:Sequence :HHHHHHHHHEEcHHHHHcGGGGcTcTTccccETcTTcEEcHHHHHGGGTcccEEEccccc:Sec Str : ===========================================================:RP:SCP|2->284|1j1lA|1e-66|32.1|268/288|b.82.1.12 :============================================================:BL:SWS|1->283|Y2418_PSEAE|2e-98|59.9|282/286 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->127|PF02678|1e-20|58.6|87/106|Pirin 61: . . . * . .: 120 :HPHRGFETVTIVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGEL:Sequence :cHHHHHHHHHHHHTTccccccTTcccccccTTccccHHHHcccHHHHcTTHHHHHTTccc:Sec Str :============================================================:RP:SCP|2->284|1j1lA|1e-66|32.1|268/288|b.82.1.12 :============================================================:BL:SWS|1->283|Y2418_PSEAE|2e-98|59.9|282/286 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->127|PF02678|1e-20|58.6|87/106|Pirin 121: . . + . . .: 180 :EMVQLWVNLPMKDKMTPPGYQSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPL:Sequence :cccccccccHHHHTTcccGGGTcccccHHHHHHccTTTccTGGGTccccTTcTTHHcccT:Sec Str :============================================================:RP:SCP|2->284|1j1lA|1e-66|32.1|268/288|b.82.1.12 :============================================================:BL:SWS|1->283|Y2418_PSEAE|2e-98|59.9|282/286 :$$$$$$$ :RP:PFM|37->127|PF02678|1e-20|58.6|87/106|Pirin 181: . * . . . .: 240 :NVWDMRLQRNRQLTLAQPEGWSTALVVLKGNITVNGTTPVNEAQLVVLSQQGKTLHLEAS:Sequence :EEEEEEEcTTcEEEEEccTTcEEEEEEEEccEEETccEEEcTTEEEEEcccccEEEEEcc:Sec Str :============================================================:RP:SCP|2->284|1j1lA|1e-66|32.1|268/288|b.82.1.12 :============================================================:BL:SWS|1->283|Y2418_PSEAE|2e-98|59.9|282/286 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|184->284|PF05726|6e-19|49.0|100/103|Pirin_C 241: + . . . . *: 300 :SDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNSGRFGQI :Sequence :ccEEEEEEEEcccccccEEETTEE ccHHHHHHHHHHHHTTcTT :Sec Str :============================================ :RP:SCP|2->284|1j1lA|1e-66|32.1|268/288|b.82.1.12 :=========================================== :BL:SWS|1->283|Y2418_PSEAE|2e-98|59.9|282/286 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|184->284|PF05726|6e-19|49.0|100/103|Pirin_C