[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68874.1 sent8 ACF68874.1 "pirin protein"
MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGE
HPHRGFETVTIVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGEL
EMVQLWVNLPMKDKMTPPGYQSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPL
NVWDMRLQRNRQLTLAQPEGWSTALVVLKGNITVNGTTPVNEAQLVVLSQQGKTLHLEAS
SDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNSGRFGQI
//