[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF68967.1 sent8 ACF68967.1 "conserved hypothetical protein"
MQLLLGRLLCTLHAFIHWQEKYKKRATHTHRATTQYFGDELRLFMAKAQDSGSHFTEMKS
EGVGVDAGGIKREECETGRLIT
//