[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69088.1"

            "putative molybdenum transport ATP-binding protein ModF"
            ""

OrgPattern 77219387777788B4F4553327I88E89D851646443623CLEJPDCZUF57CBGID953-B233 DFJ-Q8DEEEGBBDA6955-5933AO656668G9A9GOZR5C6F7FCDIDA6KDF47944CDGFFFIQNT8BBAAKFEH6I7B32423DDA819347--48B464C7C64122222244444447CA7DA69AAA8CKJLI898HAIDD998ABC88768564E8BDILE9488A767C7B76F9A22CB1BEWTTUUUTYYNXXVWXVNLLLMLYVYDKMJGFOFIIIGJgYBGGHFHFFFFGGGFGIAACFJFACLLAB8AALL78PQG98DKEBEHFFFFFGIULLKKKJLILLJIHGFFFFGGFGGFFFRGICCDKILIDVQOOSSSRTQOENBDNIICCC6TGHE8QFGDAXXCICEHH8GIELG9EE88H999589779D7TOV87CMNELGFGEIFDGDEGX-BDEBBJEEPc6-xaaUaWVlfehfUT858FMWEGHKLEL54555555A8A568BG2221133321--12223111121124132743449JUPGJHORRSKGGEGFQQWZGEGGBKNNjHAIC25LICFDECCKHNKWZACC7933C96646556C98BBBAMT6H9EB7DKBBE6HDIAAA9AH6787FDDK568A54444541223213112644444FFQ9FFE88CDA88997CCABAD99DCDCF1-43679-1-111VMdTBYMOSRPOQRQNN-QONOROQNQPQQRMMONMKYaWdhHDGFHFGGGGIGGFGGGGFaNKJQQQO92PRRSTSRNRUUU238845444556588LDPIJGJED8CFB9GCEI8998949578DA9A9AHKISHEJDDEQNN333232323BDCBMEEFFELPIJIA9555554442232332A6644892332-123E3643432-3242242333145122--158B42CHDC83C7 ----461-61-14532221122113231111111112111111-1-2122123113111223123112-231313131-223334511-3322-2-22221-1874-555826375341--23573-51Cc8282651125-255252--511C-A94B144-84B-9D9X33624-13N-3313A11613442AAEA5 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGER:Sequence : ===========================================================:RP:SCP|2->191|1sgwA|3e-21|19.4|181/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 61: . . . * . .: 120 :QCRFTRITRLSFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLA:Sequence :============================================================:RP:SCP|2->191|1sgwA|3e-21|19.4|181/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 121: . . + . . .: 180 :QQFGISALLDRRFKYLSTGETRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTA:Sequence :============================================================:RP:SCP|2->191|1sgwA|3e-21|19.4|181/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 181: . * . . . .: 240 :LNQAGMTLALVLNRFDEIPDFVQFAGVLADCTLAETGTTTELLQRALVAQLAHSERLTDV:Sequence : XXXXXXXXXXXX :SEG|212->223|tlaetgtttell :=========== :RP:SCP|2->191|1sgwA|3e-21|19.4|181/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 241: + . . . . *: 300 :QLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLSWRVNPGEHWQIVGPNGAGKS:Sequence : ========================================:RP:SCP|261->465|1sgwA|1e-26|19.8|187/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 301: . . . . + .: 360 :TLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYRVSTTVRNVIL:Sequence :============================================================:RP:SCP|261->465|1sgwA|1e-26|19.8|187/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 : $$$$$$$:RP:PFM|354->428|PF00005|2e-05|35.1|74/123|ABC_tran 361: . . . * . .: 420 :SGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP:Sequence :============================================================:RP:SCP|261->465|1sgwA|1e-26|19.8|187/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|354->428|PF00005|2e-05|35.1|74/123|ABC_tran 421: . . + . . .: 480 :TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGE:Sequence :============================================= :RP:SCP|261->465|1sgwA|1e-26|19.8|187/200|c.37.1.12 :============================================================:BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490 :$$$$$$$$ :RP:PFM|354->428|PF00005|2e-05|35.1|74/123|ABC_tran 481: . * . . . .: 540 :RYKYVSGRCNN :Sequence :===== :BL:SWS|1->485|MODF_ECOLI|0.0|85.8|485/490