[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69088.1 sent8 ACF69088.1 "putative molybdenum transport ATP-binding protein ModF"
MSSLQISQGTFRLSDTKTLHLDSLTLNAGDSWAFVGANGSGKSALARALAGELPLLTGER
QCRFTRITRLSFEQLQKLVSDEWQRNNTDMLSPGEDDTGRTTAEIIQDEVHHPARCAMLA
QQFGISALLDRRFKYLSTGETRKALLCQALMSEPELLILDEPFDGLDVTARQQLAQRLTA
LNQAGMTLALVLNRFDEIPDFVQFAGVLADCTLAETGTTTELLQRALVAQLAHSERLTDV
QLPEPDEPSARHALPDGEPRIVLNDGVVSYNDRPILHHLSWRVNPGEHWQIVGPNGAGKS
TLLSLITGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGYVSSSLHLDYRVSTTVRNVIL
SGYFDSIGIYQAVSDRQRKLAQQWLDILGIDKRTADAPFHSLSWGQQRLALIVRALVKHP
TVLILDEPLQGLDPLNRQLVRRFVDVLIRQGETQLLFVSHHAEDAPACITHRLEFVPEGE
RYKYVSGRCNN
//