[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69275.1"

            "5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase"
            ""

OrgPattern 11---11211111121-112111221122143-1111111111-----111111111-1112211-11 2221431222221253222-21113522222122323299221325211222795233--113122435211111111----5-11--11111111---11221231213---------------11-11111-111-12211123-111111----------1111111--------1----2222211-31122222222422322223111122214413111111113411111111111111111111-----------11--11-----------------------------------------------------12--1-----------211---------2---1221---1-1112111--1-17111-1--132A781135344333333332332-33533534723-5337234333228553-3643233245--------221-2412-----------------------------2-3I1-7863678A6762555277755555-564H3A6625443334225672B5331----111111111---221-21--1-1-21111111111111-111113-1---1111111--1------------11--1111--21------------------------11-------32221211221111122-2212111211212221223322223214242434444434324522122221-122244424444---1---------11125--------------1111111-1111244444326123211122-------------1---------11122222222-------1----11--------------------------------------1--------11 ----222-21---113443655398772222222213333133222434976ED44543333213-1-1-111131111112222211-22242223222212211-111424212211--12-221217F4-3231111312311-1--2-1222214422134433233112211117111--21322221212222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLVQYLVNGGKRYGIMQEIGIIDLSQRLGDKYPTLKSLLCANALTDAALWCDEPADYYY:Sequence :cEEEEE TTTEEEEEETTEEEEEccTTccEHHHHHHTcccccHHccTTccEEEEEEEG:Sec Str 61: . . . * . .: 120 :QEVTFLPVIDDPQKIICVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTN:Sequence :GGccEEccccHcccEEEEcccccccccccEEEEcGGEEccccTTcHHHHcccEEEccccc:Sec Str : =================================================:RP:SCP|72->283|1gttA1|2e-56|25.0|200/213|d.177.1.1 : ==========================================================:BL:SWS|63->275|FAHD2_XENLA|4e-45|44.8|212/319 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->275|PF01557|2e-39|46.9|196/213|FAA_hydrolase 121: . . + . . .: 180 :EFDYEGELAVVIGRRCSRVSAEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFG:Sequence :cEEccEEEEEEEccccccccHHHHGGGEEEEEEEEccEEHHHHHHccHHHHccTTcEEEE:Sec Str :============================================================:RP:SCP|72->283|1gttA1|2e-56|25.0|200/213|d.177.1.1 :============================================================:BL:SWS|63->275|FAHD2_XENLA|4e-45|44.8|212/319 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->275|PF01557|2e-39|46.9|196/213|FAA_hydrolase 181: . * . . . .: 240 :PCLVTTDDIPDPQMLRLLTRLNGREVQNESTANMIHPIASLIAYISTFTLLSPGDTILTG:Sequence :EEEEcccccccTTccEEEEEETTEEEEEEEGGGccccHHHHHHHHHTTccccTTcEEEcc:Sec Str :============================================================:RP:SCP|72->283|1gttA1|2e-56|25.0|200/213|d.177.1.1 :============================================================:BL:SWS|63->275|FAHD2_XENLA|4e-45|44.8|212/319 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|77->275|PF01557|2e-39|46.9|196/213|FAA_hydrolase 241: + . . . . *: 300 :SPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVRDSRYLTSSVSWHDGRK :Sequence :ccccccEEc cccTTcEEEEEETTTEEEEEEEEEEcc :Sec Str :=========================================== :RP:SCP|72->283|1gttA1|2e-56|25.0|200/213|d.177.1.1 :=================================== :BL:SWS|63->275|FAHD2_XENLA|4e-45|44.8|212/319 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|77->275|PF01557|2e-39|46.9|196/213|FAA_hydrolase