[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69484.1"

            "macrolide export ATP-binding/permease protein MacB"
MACB_SALTI  "RecName: Full=Macrolide export ATP-binding/permease protein macB;         EC=3.6.3.-;"

OrgPattern MME9JGCAQPQOQMRGZBJJHKKQjJMTdPTPE97899FGIFCSZFTWKOrlc7IQLNOFKACBO155 Tj*E*TRVaaeISJNLMKK-KU88R*KKKKKKjbbdi***OrL*e*iWfbWLsnlKMS33nohXvhn***UXSSSxTVSLmTh97A7AMMJH1ICCB--BDNDEITDTPJ44444448987777DOIELLHDNIOMgjktt996lUdYXjVVYTXOQJEHFJFXRVeqtlKEKAEEBDJCEECTQRMLbW7OSituwuvr**q**wqu**mlljk*y*VQavmWdifgbbe**RZbdYdYXZZaaZZYLTOPOgVNRqsPJLNQigHHlpPPJRbVWTUdbcbdXhjlifgdeeeejcefWVUUSVVUWVVUUnYZRRSaZaXb*huxuuuuxwtVpQUyttPUVO*UYWUwUYRE**baTVYOKUZSZTGIQYIWTQQHCCE9BXR***OId*zv*qx*x**s*uvv*-eg*aY*dw**P7**************FCLs*********HGHHHHHHkOREIUTy22223444333323445243232246252GDCEADq**s*******momoh****vsvvXw***wy*t9GllgoYjfj*s****PbeKLGIfQDDCCDCDONNWgXRf*DTQgfKagUSdESWSRLQZQVcZWersVoDECGDCBCC9D99ABBBBABFL7CCMLdYlHgNVCNDqIJMMKINRLLKLLMPLOOP5-AEMJH2--111rj**Prmfjilgnkmdf-ifegigmihjjmicdeccc*****SQOZbYaYZZZYYWYZYaY*aXXZaYeK2tuvvzyusvxzx23ADEFCEFJKKKNDxe*OONQNOEDEBCJJNUKLNLLBK9EKdWrojrn***kuxnoW***999788989CRcZibccccjnkqmMNKGJGHEGF978742HKIIA9DF45443444m8OA88A6-554578798747B8A5444LVXJHWhXYUBdK ----CEE-SG36BHD85955AA6E6E63344447476978776433539BAFID77C57342332-1---31-1221-2224341231-BE558335337326882-BGGhEKISKVHDIEFKIhd9kB**Z2cMUFFD8YDDUL9IDBBVAA*ENHGdCO*BSEI6MHI*HRIB8955q5644BQBDh4WJ57ePSP6 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP:Sequence : =========================================================:RP:SCP|4->229|1b0uA|1e-42|33.8|222/258|c.37.1.12 :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 : $$$$$$$$$$$$$:RP:PFM|48->172|PF00005|2e-11|37.9|116/123|ABC_tran 61: . . . * . .: 120 :TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKK:Sequence : XXXX:SEG|117->134|erkkrqararelllrlgl :============================================================:RP:SCP|4->229|1b0uA|1e-42|33.8|222/258|c.37.1.12 :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|48->172|PF00005|2e-11|37.9|116/123|ABC_tran 121: . . + . . .: 180 :RQARARELLLRLGLSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG:Sequence :XXXXXXXXXXXXXX :SEG|117->134|erkkrqararelllrlgl : ############### :PROS|145->159|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|4->229|1b0uA|1e-42|33.8|222/258|c.37.1.12 :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|48->172|PF00005|2e-11|37.9|116/123|ABC_tran 181: . * . . . .: 240 :EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAV:Sequence :================================================= :RP:SCP|4->229|1b0uA|1e-42|33.8|222/258|c.37.1.12 :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 241: + . . . . *: 300 :VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|278->296|giiigiasvvsivvvgdaa :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 301: . . . . + .: 360 :LADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQLWVNSATPSVSKSLRLRY:Sequence :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 361: . . . * . .: 420 :GNIDIAVNANGVSGDYFNVYGMSFREGNTFNDVQQQDRAQVVVLDANTRRQLFPNKANVV:Sequence : XXXXXXXXXXXXXX :SEG|392->405|dvqqqdraqvvvld :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 421: . . + . . .: 480 :GEVVLVGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGV:Sequence :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 481: . * . . . .: 540 :DSDQAEQQLTRLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGV:Sequence :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|482->639|PF02687|5e-20|39.4|155/177|FtsX 541: + . . . . *: 600 :MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQL:Sequence :============================================================:BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|482->639|PF02687|5e-20|39.4|155/177|FtsX 601: . . . . + .: 660 :FLPGWEIGFSLTALASAFLCSTFTGILFGWLPARNAARLDPVDALARE :Sequence :================================================ :BL:SWS|1->648|MACB_SALTI|0.0|99.4|648/648 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|482->639|PF02687|5e-20|39.4|155/177|FtsX