[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69484.1 sent8 ACF69484.1 "macrolide export ATP-binding/permease protein MacB"
MTALLELRNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP
TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKK
RQARARELLLRLGLSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG
EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAEEKKREQGVDAAV
VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV
LADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQLWVNSATPSVSKSLRLRY
GNIDIAVNANGVSGDYFNVYGMSFREGNTFNDVQQQDRAQVVVLDANTRRQLFPNKANVV
GEVVLVGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGV
DSDQAEQQLTRLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGV
MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQL
FLPGWEIGFSLTALASAFLCSTFTGILFGWLPARNAARLDPVDALARE
//