[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69516.1"

            "inner membrane protein YfbW"
ARNE_SALSV  "RecName: Full=Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit arnE;         Short=L-Ara4N-phosphoundecaprenol flippase subunit arnE;AltName: Full=Undecaprenyl phosphate-aminoarabinose flippase subunit arnE;"

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------111-11111-11-1111111111111111111111--1111111111111111111--1--11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQT:Sequence : XXXXXXXXXXXXXXXXX :SEG|2->18|igivlvlasllsvggql : ==========================================:BL:SWS|19->94|ARNE_SALSV|7e-44|100.0|76/111 61: . . . * . .: 120 :LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA :Sequence : XXXXXXXXXXXXXXXX :SEG|95->110|lgvaliisgiiilgsa :================================== :BL:SWS|19->94|ARNE_SALSV|7e-44|100.0|76/111