[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69516.1 sent8 ACF69516.1 "inner membrane protein YfbW"
MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQT
LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
//