[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69636.1"

            "2,5-diketo-D-gluconic acid reductase A"
            ""

OrgPattern 112-2112333333322322211-72282761----------------------11111122211--- 132-221344525124411-12222211111123332644-2236452-43-76721211--112-833312344432-1111-----311---------1--213-12---------------11-----------111----3-11-2--1-------1--11121----------------1---1--3144444443433443342233344331133445444444261665556566666664443627834434435777776255465444222111113311111111111111-1111111111111111113---1211122122131-------1--1--22----------------2-11--211------2-4221-32132211111111113-1131231431--333242343223121-1-1-111111-2222222212221--1------------------------------21--3-332222222221-1122321112122211112--112--1--1--12-11-----1------------1------1----1----1--1--2--121133----3---------3--------------2212-1--2-1------1-21--------1--1----------24231333555355544-5334554353555333334546221224344555555445455535333341-444444434444-----1-1-1121111221-16-3---------1111112-111-1111233223333-111-------------------1----21-2-221111------611-111111-------3-----------1------5-------121-21222--2 ----647-8532235A9BDGDE9HFGF8844557868888888545DB8FEEOGEH975777D8A36B7656B4A5667668889855-LiF98G9ABAC759E7711f4aLK788KA86CFAFQP6O7b*E1JAL8765934SK64663H6B88A96E8645BFEFBCGOQD941445r334768ELD9EE9BC488R -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEYSILSNNLKMPMVGFGVFKVTDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVR:Sequence :TTcEEEcTTcEEEcccEEcccccccHHHHHHHHHHHHHTccEEEccGGGccHHHHHHHHH:Sec Str : ################## :PROS|39->56|PS00798|ALDOKETO_REDUCTASE_1|PDOC00061| :============================================================:RP:SCP|1->266|1a80A|7e-60|42.3|260/277|c.1.7.1 : =======================================================:BL:SWS|6->263|GR_BACSU|2e-60|48.2|251/276 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->261|PF00248|2e-32|42.5|233/281|Aldo_ket_red 61: . . . * . .: 120 :KAIATGLCTREELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFS:Sequence :HHHHHHTccGGGcEEEEEEcGGGcccHHHHHHHHHHHHHHHTcccccEEEEcccTTTHHH:Sec Str :============================================================:RP:SCP|1->266|1a80A|7e-60|42.3|260/277|c.1.7.1 :============================================================:BL:SWS|6->263|GR_BACSU|2e-60|48.2|251/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->261|PF00248|2e-32|42.5|233/281|Aldo_ket_red 121: . . + . . .: 180 :AWRALEDAYEAGKLKAIGVSNFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKH:Sequence :HHHHHHHHHHTTccccEEEEcccHHHHHHHHHHccccccEEEEEccTTcccHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->266|1a80A|7e-60|42.3|260/277|c.1.7.1 :============================================================:BL:SWS|6->263|GR_BACSU|2e-60|48.2|251/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->261|PF00248|2e-32|42.5|233/281|Aldo_ket_red 181: . * . . . .: 240 :YNVQPEAWAPLGGGRHKPYENVMLQRIADAHQKTIAQVVLRWNVQRGVTVIPKSTRQERI:Sequence :HTcEEEEEcTTGGGTTccTTcHHHHHHHHHHTccHHHHHHHHHHHTTcEEccccccHHHH:Sec Str :============================================================:RP:SCP|1->266|1a80A|7e-60|42.3|260/277|c.1.7.1 :============================================================:BL:SWS|6->263|GR_BACSU|2e-60|48.2|251/276 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->261|PF00248|2e-32|42.5|233/281|Aldo_ket_red 241: + . . . . *: 300 :EENFAIWDFSLTDNEMAQINALDLGYVGEAVKHFNPEFVRGCLGVKIHD :Sequence :HHHTccccccccHHHHHHHHTTcccccTHHHGGGccccccHHHHHc :Sec Str :========================== :RP:SCP|1->266|1a80A|7e-60|42.3|260/277|c.1.7.1 :======================= :BL:SWS|6->263|GR_BACSU|2e-60|48.2|251/276 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|24->261|PF00248|2e-32|42.5|233/281|Aldo_ket_red