[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69712.1"

            "large repetitive protein"
            ""

OrgPattern --------------------------------------1----------11-1-------------1- --2-----------------------------1------------2-----2111----------1-----------------------------------2-1171--2-----------------1---11--211142---1-------------------3------------------12-------------------------111------1--1-1-------31--------------1-1211------------------1---112-------1--------------------------1------------1-----------1-----------11-----1-------111-------1-----------1--1-1---1---------------3-------2------1----------3-------11---------1----52-----------------------------------11231-1--1-2-----11--111-1----1--1---121----2---23--1--113--------1-1--1211-21--1-1----253-25E-2----4--113-------------------------4221-42-1-21-111--211112121145--------------1---1--231-------2---1---1-3-2-----21--33---2312222222131325---5-------11111111211--3------------212---------------34653311-4-31111--2--2321-------------1122------12-22---1-11---------1--------------------------------------1---------------3- ---------------------------------------------------------------------------------------2-------------------------------------------------------------------------2------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLLAVVSKLTGVSTTVESSAVTLNAPSIVKLSVAREEISQLTRINQDLVVTLHSGETIT:Sequence : :Sec Str 61: . . . * . .: 120 :IKNFYVTNDLGASQLVLAENDGTLWWVENPQAGLHFEQIADINELLVTSGASHEAGGAVW:Sequence : :Sec Str : XXXXXX:SEG|115->185|aggavwpwvlagavaaggiaaiassgggdshhhsdgdnpppdntnpdgnppdnsnpggsnpngntpgssnp 121: . . + . . .: 180 :PWVLAGAVAAGGIAAIASSGGGDSHHHSDGDNPPPDNTNPDGNPPDNSNPGGSNPNGNTP:Sequence : :Sec Str :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|115->185|aggavwpwvlagavaaggiaaiassgggdshhhsdgdnpppdntnpdgnppdnsnpggsnpngntpgssnp 181: . * . . . .: 240 :GSSNPVDTTPPLAPGKLLISADGKTVSGEAEAGSTITIKDPSGNVVGEGKADSDGKFSID:Sequence : EEEEEcccccccEEcEEEcccccTTcccccEEEEEE:Sec Str :XXXXX :SEG|115->185|aggavwpwvlagavaaggiaaiassgggdshhhsdgdnpppdntnpdgnppdnsnpggsnpngntpgssnp 241: + . . . . *: 300 :LTAPQLSGEQLTVTATDDAGNTGPSATIDAPNIPLLDTPAITAAIDDAAPLTGTLSNNQF:Sequence :EEEcTTcEEEEEEEEEETTcccccc :Sec Str : XXXXXXXXXXXXXXXXX :SEG|276->292|ldtpaitaaiddaaplt : =====:BL:SWS|296->466|SUBF_BACSU|3e-05|24.6|151/1433 301: . . . . + .: 360 :TNDNTPTLEGTGSAGTVIHIYANGQEIGSTTVDSSGSWRFAITSALADGENHFTAIATNV:Sequence : ccEEcEEEEEETTEEEEEEE cTTccEEEEcTTTcccEEEEEEEEEEcc:Sec Str : ================================================ :RP:SCP|312->359|2je8A4|3e-04|21.3|47/192|b.18.1.5 :============================================================:BL:SWS|296->466|SUBF_BACSU|3e-05|24.6|151/1433 361: . . . * . .: 420 :KGESSESARFTLTIDTLSPDAPRVELIADNTGLLTGPLQNNDRTDEAKPLFSGQGEAGNT:Sequence : :Sec Str :============================================================:BL:SWS|296->466|SUBF_BACSU|3e-05|24.6|151/1433 421: . . + . . .: 480 :ITIKEGSTVIGSATVDENGRWTFTPTTPLSDGEHTFTVEQSDKAGNTSRVTTTPTIIVDT:Sequence : :Sec Str : XXXXXXXXXXX:SEG|470->484|vtttptiivdttppd :============================================== :BL:SWS|296->466|SUBF_BACSU|3e-05|24.6|151/1433 481: . * . . . .: 540 :TPPDAAIIDNVAKDGTTVSGTAEAGSTVSIYDPAGNYLGSTITGENNHFSITLNPAQTHG:Sequence : :Sec Str :XXXX :SEG|470->484|vtttptiivdttppd : =============================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 541: + . . . . *: 600 :ERLEARIQDAVGNIGPATEFTASDSQYPAQPTILTVTDDAGAVTGLLKNGDATDDNRPTL:Sequence : EEEEEEEEEcccccEEEEEEccccEEEEEEcccccccccTTcT:Sec Str :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 601: . . . . + .: 660 :SGTAEPGSTISINDNGFPVPTFPPIVADADGKWSFTPSLALADGDHVFTATATNDRGTSG:Sequence :TcccGGGcccTTccccEEEEEEEcccccTTcEEEEEEccccccEEEEEEEEEEcccccTT:Sec Str :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 661: . . . * . .: 720 :QSVSFTIDIDTQPPVLEGLAVSDVGDRLTGTTEAGSTVVIKDSQGNTLGSGTAGDDGTFS:Sequence :ccccccccEEEccTTcccTTTTEEEcGGGccccccEEEEEccTTTTcTTGGGcccccccc:Sec Str :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 721: . . + . . .: 780 :IGISPAKINGETLSISVTDKAANSGPVETLNAPDKTAPAAPDGLIVATDGLSVSGQAEAG:Sequence :TTEEEEEEccccccEEEEEEcTTTccccTTcEEEEEEEEEEccTTcEEEEEEEccTTccc:Sec Str :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 781: . * . . . .: 840 :ATVTIRDSSNTVLGSAVANGNGQFIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDS:Sequence :TTccGGGcEEEcccccTTccccEEEEEEEEccTTccEEEEEEEcccccccTTccHHHHHH:Sec Str :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 841: + . . . . *: 900 :TAPEMPKNVVISEDGTSISGTAEPGSAITIATPDGKPLGSGKADGEGHFTLPLVPAQTNG:Sequence :HTTTEEEEEEEEEEcccHHHHHHHHHHHHHHHTEcccccTTcccccEEEEEEccEETTcc:Sec Str :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 901: . . . . + .: 960 :EQVTVTATDSANNVSPPTTAQAPDITAPDKPIITQVLDDVESFTGPLVNGQTTNDNRPTL:Sequence :EEccEEEccccccccEEEEEEETTEEEEEcccccccTTTTTEEccEEccccccccccccc:Sec Str : ============:RP:SCP|949->1019|1ogpA1|2e-05|21.1|71/127|b.1.18.6 :============================================================:BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 961: . . . * . .:1020 :SGTAEAGARVEVFDNGVSLGLATLQPNGGWTFTPSQNLGEGAHRLTVIATDAKGNASPAA:Sequence :cccEEEEEEcEcccEEEEEEcEEccccEEEEEcccEEcTTcEEEEEEEcTTcccEEEccc:Sec Str :=========================================================== :RP:SCP|949->1019|1ogpA1|2e-05|21.1|71/127|b.1.18.6 :=================================================== :BL:SWS|496->1011|TCNA_TRYCR|5e-08|18.5|483/1162 : ===============:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1021: . . + . . .:1080 :SFDLVVDTQSPQQPVITFITDDAPGILGSVAHLGLTNDSTPTINGTGEPGSTVHLYQNGA:Sequence :cccccccTccccccccccEEETTTTcEEEEEEEccccTTcccTTcccccccEEEEEEETT:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1081: . * . . . .:1140 :RIADIIVGNSGVWSYAYTTASPLADDTYTFTVTASDSNGNTTPFSTDFTITIDTQAPAAP:Sequence :EEEEEEEEEcccccEEEEEEcccTTcEEEEEEEEEcTTcccccccccEEEEEEETTEEEE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1141: + . . . . *:1200 :GVIGVADGDGNTIDTNQITQESQPRLSGSGTAGDTIILYDNGNAIGQALVGTDGRWQFTP:Sequence :EEEEEcTTTTTcccEEEEEcccccEccTTccEEEEEEEEETTEEEEEEEEcccccccccc:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1201: . . . . + .:1260 :PAALGDGDHLLTARANDPAGNESPESISFTLRIDTQAPDAPQIVSAAITGGEGEVLLANG:Sequence :EEEcccccccEEEEccccccccccEEEEEEEEEEccccEEccGGGcEEEEEccc cEEEc:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1261: . . . * . .:1320 :SITNQRMPTLSGTGEPGTIITLYNNGVELATVQVNPQGSWTYPLTRNLSEGLNILTATAT:Sequence :ccTTTTccccTTcHHHHccccccEEEEEEEETTTccccEEcccccccccccccccccccc:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1321: . . + . . .:1380 :DAAGNSSPTSGVFSVTLDTQPPAQPDAPLISDNVAPVIGNIGNNGATNDTTPTFSGTGEI:Sequence :cEEcccEEEEcccccccTTTcccccccEEETTccccccccccccEEEEccccTccccEEE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1381: . * . . . .:1440 :GSTIILYNNGSEIGRTTVGDNGSWSFTPAALTPETYTITVTETDIAGNISPPSASVTFTL:Sequence :EEEEccccccTTccccEEEEEEEcccEEEEEEEEcccccTTccccccccEEEccTTcccT:Sec Str : XXXXXXXXXXXX :SEG|1412->1423|tpetytitvtet :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1441: + . . . . *:1500 :DTTAPANPVITFAEDNVGEVQDTIVSGATTDDNTPVIHGTGDIGSVITLYNGSSVVGVVT:Sequence :TTTEEEcGGccEEEEEccTTTTcTTGGGccccccccTTEEEEEEccccccEEEEEEcTTT:Sec Str : XXXXXXXXX:SEG|1492->1506|gssvvgvvtvdetgt :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1501: . . . . + .:1560 :VDETGTWTLPVTSALPDGVYTLTAIAADAAGNSSDVSNSFTFTVDTVPLQPPVVNEILDD:Sequence :ccccTTcEEEEEEEEEEcccccccTTccTTTccGGGcccccccccEEEEEEccTTcEEcc:Sec Str :XXXXXX :SEG|1492->1506|gssvvgvvtvdetgt :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1561: . . . * . .:1620 :VAPVTGPLTDGAFTNDRTLTINGSGENGSTVTIYDNGVAIGTALVTDGTWTFNTPELSEV:Sequence :EEEEEEEEEccTTccEEEEEEEcccccccEEcEEEcccccTTcccccEEEEEEEEEcTTc:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1621: . . + . . .:1680 :SHALTFSATDDAGNTTAQTQPITITVDITAPPAPTIQTVDDDGTRVAGLADPYATVEIHH:Sequence :EEEEEEEEEETTccccHcccccGGGccTTcccccccEEEHHHHHHHH :Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1681: . * . . . .:1740 :ADGTLVGSAIANGTGEFVVTLSPAQTDGGTLTAIAIDRAGNNGPATNFPASDSGLPAVPA:Sequence : :Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1741: + . . . . *:1800 :ITAIEDDVGSVQGNIAAGGATDDTTPTLRGTTDIGSTVEVFIDGDSAGFATVDASGNWIF:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|1756->1773|aaggatddttptlrgttd :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1801: . . . . + .:1860 :EIATPLSESTHYFTVQATNANGPGGLSAPVGITVDLSVPAQPVITSATDDVPGMTGTLDN:Sequence : TccEEccEEEccccccccEEEEEEETTEEEEccccccccTTTTTEETccEEcc:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1861: . . . * . .:1920 :GALTNDSRPTLNGTGEAGATIRILDNGVEIGSATVDQSGNWRFTPNAPLENIAHIFTAVA:Sequence :ccccccccccccccEEEEEEEEEEcccEEEEEEcEEccccEEEEEEcccTTcEEcEEEEE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 1921: . . + . . .:1980 :TDPAGNSGQPSDGFTLNIDAQAPDVPVITSVIDDNNQPTVPVLPGQSTDDRQPILNGTGE:Sequence :EcTTcccccccEEEEGTcccEEEEETTTEEcccEEEcccccEEEcccEEcccccccEEEE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1946->2051|PF12245|8e-04|37.0|100/675|DUF3607 1981: . * . . . .:2040 :PGATITIFDNGTPLGTAQVGENGSWTFPVPRNLSEGSHNLTVSATDPAGNTSAVSAPWTI:Sequence :EEEEcccccccEEEEEEEEcEEccccccEEccTTccccEEEEcEEETTTEEccEEEEEEE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1946->2051|PF12245|8e-04|37.0|100/675|DUF3607 2041: + . . . . *:2100 :VVDITPPAIPVLTSVVDDQPGITGNLVSGQLTNDATPTLNGRGEAGATINVYLDGNPASI:Sequence :EEEEcccccEEEccccccccEETTcEEEEccTTTTTTTTcccEEEEEEcccTTcccEEEE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 :$$$$$$$$$$$ :RP:PFM|1946->2051|PF12245|8e-04|37.0|100/675|DUF3607 2101: . . . . + .:2160 :GTTTVNSDGTWSFTPQTPLANGSHTFTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIAS:Sequence :EEEEEEccccccEEEEEccccccEEEcccccccEEcccccEEEEEEEEETTcccTccccE:Sec Str :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2134->2203|PF01297|2e-04|30.0|70/291|SBP_bac_9 2161: . . . * . .:2220 :VADNTAPVTGIVPNGGSTNETRPTLSGTGEAGTTISIYNGSALVGTAQVQANGSWSFTPS:Sequence :EEEEEEEEETTccEEEcccEEEEccccccEEEEEEcccTTEEEEEEEEEEccTTccGGGc:Sec Str : ===================================================:RP:SCP|2170->2463|1dabA|6e-07|7.8|294/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|2134->2203|PF01297|2e-04|30.0|70/291|SBP_bac_9 2221: . . + . . .:2280 :TSLGAGVWNLTATATDAAGNTSAASEIRSFTIDTTAPAAPVIDTVYDGTGPITGNLSSGQ:Sequence :cEEEEEEEEcccTTccccEEEEccccccccTTcEEEEEEEccccccccccEEEEEEETTE:Sec Str :============================================================:RP:SCP|2170->2463|1dabA|6e-07|7.8|294/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2281: . * . . . .:2340 :ITDEARPVISGTRETNTTIRLYDNGTLLAEIPADNSSSWRYTPDASLATGNHVITVIAVD:Sequence :EEEEEEEEcccccccEEEEEEccGEEEEccccccEEEEEEEEEEcccccccccccEEccc:Sec Str :============================================================:RP:SCP|2170->2463|1dabA|6e-07|7.8|294/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2341: + . . . . *:2400 :AAGNASPVSDSVNFVVDTTPPLTPVITSVSDDQAPGLGTIANGQNTNDPTPTFSGTAEAG:Sequence :cEcccccTTcEEEEEEEccccEEEEEccEETTTTcccccTTcHHHHHHHTTTTccccccc:Sec Str :============================================================:RP:SCP|2170->2463|1dabA|6e-07|7.8|294/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2401: . . . . + .:2460 :ATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNSSPNSTAFTLTVD:Sequence :cccccHHHHHHTTEEEEcccccTTcEEEEEEEEEEccTTcEEEEEEEccTTcccTTccGG:Sec Str :============================================================:RP:SCP|2170->2463|1dabA|6e-07|7.8|294/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2461: . . . * . .:2520 :TTAPQTPILTSVVDDVAGGVTGNLANGQITNDNRPTLNGTAEAGSVVSIYDGDTLLGVTS:Sequence :GcEEEcccccTTccccEEEEEEEEccTTccEEEEEEEcccccccTTccHHHHHHHTTTEE:Sec Str :=== :RP:SCP|2170->2463|1dabA|6e-07|7.8|294/539|b.80.1.7 : ====================================:RP:SCP|2485->2561|1ogpA1|2e-04|17.5|77/127|b.1.18.6 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2521: . . + . . .:2580 :ANASGAWSFTPTTGLNDGTRTLTVTATDPAGNVSPATSGFTIVVDTLAPTVPLITSIVDD:Sequence :EEEEEEEEcccHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHTccTTcEEEEEEEcc:Sec Str :========================================= :RP:SCP|2485->2561|1ogpA1|2e-04|17.5|77/127|b.1.18.6 : =============:RP:SCP|2568->2827|1dabA|2e-05|7.1|260/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2581: . * . . . .:2640 :VPNNTGAIGNGQSTNDTQPTLNGTAEANSAVSIFDNGALVATVNANASGNWSWTPTAALG:Sequence :cHHHHHHHHHHHHHHHccHHHHHHHTccTTccHHHHHHHHHHccTTcEEEEEEEEEEccc:Sec Str :============================================================:RP:SCP|2568->2827|1dabA|2e-05|7.1|260/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2641: + . . . . *:2700 :QGSHAYSVSAADAAGNVSAASPSITIIVDTIAPGAPGNLVINATGNRVTGTAEAGSTVTI:Sequence :EEEEEccccEEEEEEEccccEETTEEEEEEEEccccccccGGGccGGGcEEEEccccccc:Sec Str : XXXXXXXXXXXXXXX :SEG|2647->2661|svsaadaagnvsaas :============================================================:RP:SCP|2568->2827|1dabA|2e-05|7.1|260/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2701: . . . . + .:2760 :TSETGVVLGTATADGTGSFTATLTPAQTNGQPLLAFAQDKAGNTGIAAGFTAPDTRVPEA:Sequence :cccEEEEEEEEEccccccTTccEEEEcTTccEEEEEcccHHHHccccccEEcccEEEEEE:Sec Str :============================================================:RP:SCP|2568->2827|1dabA|2e-05|7.1|260/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2761: . . . * . .:2820 :PIITNVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATVSIYNNGALLGTTTANASGNW:Sequence :EEEEccccccEEEEEccTTcEEEEEEccccTTEcccccccEEEEEEEEEEETTEEEEEEE:Sec Str :============================================================:RP:SCP|2568->2827|1dabA|2e-05|7.1|260/539|b.80.1.7 :============================================================:BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2821: . . + . . .:2880 :SFTPTGNLTEGSHAFTATATNANGTGSVSTAATVIVDTLAPGTPSGTLSADGGSLSGLAE:Sequence :EEE :Sec Str : XXXXXXXXXXXXX :SEG|2834->2846|aftatatnangtg :======= :RP:SCP|2568->2827|1dabA|2e-05|7.1|260/539|b.80.1.7 :================================================== :BL:SWS|1006->2870|YHU2_SCHPO|4e-27|22.5|1724/3971 2881: . * . . . .:2940 :ANSTVTVTLTGGVTLTTTAGSNGAWSLTLPTKQIEGQLINVTATDAAGNASGTLGITAPV:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|2884->2898|tvtvtltggvtlttt 2941: + . . . . *:3000 :LPLAARDNITSLDLTSTAVTSTQNYSDYGLLLVGALGNVASVLGNDTAQVEFTIAEGGTG:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|2969->2984|glllvgalgnvasvlg 3001: . . . . + .:3060 :DVTIDAAATGIVLSLLSTQEIVVQRYDTSLGAWTTIVNTAVGDFANLLTLTGSGVTLNLS:Sequence : :Sec Str 3061: . . . * . .:3120 :GLGEGQYRVLTYNTSLLATGSYTSLDVDVHQTSAGIISGPTISTGNVMADDTAPTGTTVT:Sequence : :Sec Str : XXXXXXXXXXXX:SEG|3109->3128|addtaptgttvtaitnangv 3121: . . + . . .:3180 :AITNANGVSTPVGAGGVDILGQYGTLHINQDGSYTYTLTKPTAGYGHKESFTYTITQNGV:Sequence : :Sec Str :XXXXXXXX :SEG|3109->3128|addtaptgttvtaitnangv 3181: . * . . . .:3240 :GSSAAQLVINLGPAPVPGSVIATDNNASLVFDTHVSYVNNGPSTQSGVTVLSVGLGNVLN:Sequence : :Sec Str : XXXXXXXXXXXXXX:SEG|3227->3244|gvtvlsvglgnvlnanll 3241: + . . . . *:3300 :ANLLDDMTNPIIFNVEEGATRTMTLQGTVGGVSLVSTFDLYVYRFNDAIQQYEQFRVQKG:Sequence : :Sec Str :XXXX :SEG|3227->3244|gvtvlsvglgnvlnanll 3301: . . . . + .:3360 :WINTLLLAGQSQPLTLTLPGGEYLFVLNTASGISVLTGYTLAISQDHTYAVDSITANTTG:Sequence : :Sec Str 3361: . . . * . .:3420 :NVLTNDVVPTDALLTEVNGVAIAATGTTEVNGLYGSLIIDARGNYTYTLKNGVGADSIKT:Sequence : :Sec Str 3421: . . + . . .:3480 :PDSFIYTVKAPNGDTDTASLNITPTARALDAINDVSDTLSVATLQDTAAWLDSSVGSASW:Sequence : :Sec Str : XXXXX:SEG|3476->3491|gsaswgllgksgsgsg 3481: . * . . . .:3540 :GLLGKSGSGSGTFDVATGTVLKGASLVFDVSTLITLGNLNISWAIQENGTVIRNGTVPVA:Sequence : cccEEEEE cccEEccc EEccccEE EEEEE:Sec Str :XXXXXXXXXXX :SEG|3476->3491|gsaswgllgksgsgsg : ==========================================:RP:SCP|3499->3568|1bglA2|9e-05|15.7|70/105|b.1.4.1 3541: + . . . . *:3600 :NITLGSATVTVNLSGLELDAGTYTLNFTGTNTLAGAATITPRVIGTTVDLDNFETSGTHT:Sequence :ccccEEEEEEEEETTEEEEEEEEEEEEE :Sec Str :============================ :RP:SCP|3499->3568|1bglA2|9e-05|15.7|70/105|b.1.4.1 3601: . . . . + .:3660 :VLGNIFDGSDAAGAMDQLNTVNTRLSISGYNGSAATLDAAANTTSATIQGHYGTLQINLD:Sequence : :Sec Str 3661: . . . * . .:3720 :GAYTYTLNNGVAMSSITSKEVFTYQLDDKMGHTDSATLTIDMAPQIVSTNQNDVLIGSAY:Sequence : :Sec Str 3721: . . + . . .:3780 :GDTLIYHLLNGADATGGNGVDRWQNFSTAQGDKIDIHELLTGWDHQAATLGNFVQVHTSG:Sequence : :Sec Str 3781: . * . . . .:3840 :ANTVISVDRDGTGSAFKSTDLVTLENVQLTLNDLLQNNHLITGG :Sequence : :Sec Str