[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69712.1 sent8 ACF69712.1 "large repetitive protein"
MRLLAVVSKLTGVSTTVESSAVTLNAPSIVKLSVAREEISQLTRINQDLVVTLHSGETIT
IKNFYVTNDLGASQLVLAENDGTLWWVENPQAGLHFEQIADINELLVTSGASHEAGGAVW
PWVLAGAVAAGGIAAIASSGGGDSHHHSDGDNPPPDNTNPDGNPPDNSNPGGSNPNGNTP
GSSNPVDTTPPLAPGKLLISADGKTVSGEAEAGSTITIKDPSGNVVGEGKADSDGKFSID
LTAPQLSGEQLTVTATDDAGNTGPSATIDAPNIPLLDTPAITAAIDDAAPLTGTLSNNQF
TNDNTPTLEGTGSAGTVIHIYANGQEIGSTTVDSSGSWRFAITSALADGENHFTAIATNV
KGESSESARFTLTIDTLSPDAPRVELIADNTGLLTGPLQNNDRTDEAKPLFSGQGEAGNT
ITIKEGSTVIGSATVDENGRWTFTPTTPLSDGEHTFTVEQSDKAGNTSRVTTTPTIIVDT
TPPDAAIIDNVAKDGTTVSGTAEAGSTVSIYDPAGNYLGSTITGENNHFSITLNPAQTHG
ERLEARIQDAVGNIGPATEFTASDSQYPAQPTILTVTDDAGAVTGLLKNGDATDDNRPTL
SGTAEPGSTISINDNGFPVPTFPPIVADADGKWSFTPSLALADGDHVFTATATNDRGTSG
QSVSFTIDIDTQPPVLEGLAVSDVGDRLTGTTEAGSTVVIKDSQGNTLGSGTAGDDGTFS
IGISPAKINGETLSISVTDKAANSGPVETLNAPDKTAPAAPDGLIVATDGLSVSGQAEAG
ATVTIRDSSNTVLGSAVANGNGQFIVPLNTAQTNGQALIATATDVAKNESAAATVIAPDS
TAPEMPKNVVISEDGTSISGTAEPGSAITIATPDGKPLGSGKADGEGHFTLPLVPAQTNG
EQVTVTATDSANNVSPPTTAQAPDITAPDKPIITQVLDDVESFTGPLVNGQTTNDNRPTL
SGTAEAGARVEVFDNGVSLGLATLQPNGGWTFTPSQNLGEGAHRLTVIATDAKGNASPAA
SFDLVVDTQSPQQPVITFITDDAPGILGSVAHLGLTNDSTPTINGTGEPGSTVHLYQNGA
RIADIIVGNSGVWSYAYTTASPLADDTYTFTVTASDSNGNTTPFSTDFTITIDTQAPAAP
GVIGVADGDGNTIDTNQITQESQPRLSGSGTAGDTIILYDNGNAIGQALVGTDGRWQFTP
PAALGDGDHLLTARANDPAGNESPESISFTLRIDTQAPDAPQIVSAAITGGEGEVLLANG
SITNQRMPTLSGTGEPGTIITLYNNGVELATVQVNPQGSWTYPLTRNLSEGLNILTATAT
DAAGNSSPTSGVFSVTLDTQPPAQPDAPLISDNVAPVIGNIGNNGATNDTTPTFSGTGEI
GSTIILYNNGSEIGRTTVGDNGSWSFTPAALTPETYTITVTETDIAGNISPPSASVTFTL
DTTAPANPVITFAEDNVGEVQDTIVSGATTDDNTPVIHGTGDIGSVITLYNGSSVVGVVT
VDETGTWTLPVTSALPDGVYTLTAIAADAAGNSSDVSNSFTFTVDTVPLQPPVVNEILDD
VAPVTGPLTDGAFTNDRTLTINGSGENGSTVTIYDNGVAIGTALVTDGTWTFNTPELSEV
SHALTFSATDDAGNTTAQTQPITITVDITAPPAPTIQTVDDDGTRVAGLADPYATVEIHH
ADGTLVGSAIANGTGEFVVTLSPAQTDGGTLTAIAIDRAGNNGPATNFPASDSGLPAVPA
ITAIEDDVGSVQGNIAAGGATDDTTPTLRGTTDIGSTVEVFIDGDSAGFATVDASGNWIF
EIATPLSESTHYFTVQATNANGPGGLSAPVGITVDLSVPAQPVITSATDDVPGMTGTLDN
GALTNDSRPTLNGTGEAGATIRILDNGVEIGSATVDQSGNWRFTPNAPLENIAHIFTAVA
TDPAGNSGQPSDGFTLNIDAQAPDVPVITSVIDDNNQPTVPVLPGQSTDDRQPILNGTGE
PGATITIFDNGTPLGTAQVGENGSWTFPVPRNLSEGSHNLTVSATDPAGNTSAVSAPWTI
VVDITPPAIPVLTSVVDDQPGITGNLVSGQLTNDATPTLNGRGEAGATINVYLDGNPASI
GTTTVNSDGTWSFTPQTPLANGSHTFTLSATDPAGNSSAVSSGFVLTIDATPPAAPVIAS
VADNTAPVTGIVPNGGSTNETRPTLSGTGEAGTTISIYNGSALVGTAQVQANGSWSFTPS
TSLGAGVWNLTATATDAAGNTSAASEIRSFTIDTTAPAAPVIDTVYDGTGPITGNLSSGQ
ITDEARPVISGTRETNTTIRLYDNGTLLAEIPADNSSSWRYTPDASLATGNHVITVIAVD
AAGNASPVSDSVNFVVDTTPPLTPVITSVSDDQAPGLGTIANGQNTNDPTPTFSGTAEAG
ATITLYENGTVIGTTTAQPDGAWSVSTSTLASGTHVITAVATDAAGNSSPNSTAFTLTVD
TTAPQTPILTSVVDDVAGGVTGNLANGQITNDNRPTLNGTAEAGSVVSIYDGDTLLGVTS
ANASGAWSFTPTTGLNDGTRTLTVTATDPAGNVSPATSGFTIVVDTLAPTVPLITSIVDD
VPNNTGAIGNGQSTNDTQPTLNGTAEANSAVSIFDNGALVATVNANASGNWSWTPTAALG
QGSHAYSVSAADAAGNVSAASPSITIIVDTIAPGAPGNLVINATGNRVTGTAEAGSTVTI
TSETGVVLGTATADGTGSFTATLTPAQTNGQPLLAFAQDKAGNTGIAAGFTAPDTRVPEA
PIITNVVDDVGIYTGAIANGQVTNDAQPTLNGTAQAGATVSIYNNGALLGTTTANASGNW
SFTPTGNLTEGSHAFTATATNANGTGSVSTAATVIVDTLAPGTPSGTLSADGGSLSGLAE
ANSTVTVTLTGGVTLTTTAGSNGAWSLTLPTKQIEGQLINVTATDAAGNASGTLGITAPV
LPLAARDNITSLDLTSTAVTSTQNYSDYGLLLVGALGNVASVLGNDTAQVEFTIAEGGTG
DVTIDAAATGIVLSLLSTQEIVVQRYDTSLGAWTTIVNTAVGDFANLLTLTGSGVTLNLS
GLGEGQYRVLTYNTSLLATGSYTSLDVDVHQTSAGIISGPTISTGNVMADDTAPTGTTVT
AITNANGVSTPVGAGGVDILGQYGTLHINQDGSYTYTLTKPTAGYGHKESFTYTITQNGV
GSSAAQLVINLGPAPVPGSVIATDNNASLVFDTHVSYVNNGPSTQSGVTVLSVGLGNVLN
ANLLDDMTNPIIFNVEEGATRTMTLQGTVGGVSLVSTFDLYVYRFNDAIQQYEQFRVQKG
WINTLLLAGQSQPLTLTLPGGEYLFVLNTASGISVLTGYTLAISQDHTYAVDSITANTTG
NVLTNDVVPTDALLTEVNGVAIAATGTTEVNGLYGSLIIDARGNYTYTLKNGVGADSIKT
PDSFIYTVKAPNGDTDTASLNITPTARALDAINDVSDTLSVATLQDTAAWLDSSVGSASW
GLLGKSGSGSGTFDVATGTVLKGASLVFDVSTLITLGNLNISWAIQENGTVIRNGTVPVA
NITLGSATVTVNLSGLELDAGTYTLNFTGTNTLAGAATITPRVIGTTVDLDNFETSGTHT
VLGNIFDGSDAAGAMDQLNTVNTRLSISGYNGSAATLDAAANTTSATIQGHYGTLQINLD
GAYTYTLNNGVAMSSITSKEVFTYQLDDKMGHTDSATLTIDMAPQIVSTNQNDVLIGSAY
GDTLIYHLLNGADATGGNGVDRWQNFSTAQGDKIDIHELLTGWDHQAATLGNFVQVHTSG
ANTVISVDRDGTGSAFKSTDLVTLENVQLTLNDLLQNNHLITGG
//