[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69765.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22---212222222222-2222222222222222222222-----2222222222222222-2222222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVD:Sequence :ccHHHHHHHHTccHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHH:Sec Str :============================================= :RP:SCP|1->45|1g4dA|1e-05|31.1|45/69|a.6.1.7 :============================================================:BL:SWS|1->115|YFEC_SHIFL|3e-46|78.9|114/114 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->114|PF07037|5e-36|71.7|113/116|DUF1323 61: . . . * . .: 120 :HHADTFTPASNASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDSK :Sequence :HHHHHHHHHcHHHHHHHHHHHHH :Sec Str :======================================================= :BL:SWS|1->115|YFEC_SHIFL|3e-46|78.9|114/114 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->114|PF07037|5e-36|71.7|113/116|DUF1323