[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "sent8:ACF69854.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-1111111111-1111111111111111111111-----1111111111111111-1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGLVTWIISFWLAGFIIR:Sequence :============================================================:BL:SWS|1->71|YAIZ_ECOLI|1e-32|85.7|70/70 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->65|PF10953|4e-27|87.7|65/70|DUF2754 61: . . . * . .: 120 :RREDDEVKDAR :Sequence :=========== :BL:SWS|1->71|YAIZ_ECOLI|1e-32|85.7|70/70 :$$$$$ :RP:PFM|1->65|PF10953|4e-27|87.7|65/70|DUF2754