[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF69854.1 sent8 ACF69854.1 "conserved hypothetical protein"
MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGLVTWIISFWLAGFIIR
RREDDEVKDAR
//